Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Intra Acrosomal,SP-10 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P26436
Molecular weight:
29.7kDa

Original price was: €256.00.Current price is: €210.00.

50ug 18% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Intra Acrosomal,SP-10 recombinant protein

Product name PX-P4029-1MG
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only.
Molecular Constructor
Full-length Yes
Product name Human Intra Acrosomal,SP-10 recombinant protein
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Intra Acrosomal,SP-10 recombinant protein
Uniprot ID P26436
Uniprot link http://www.uniprot.org/uniprot/P26436
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Molecular weight 29.7kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10
Reference PX-P4029
Note For research use only
Molecular Constructor
Full-length Yes

Human Intra Acrosomal,SP-10 recombinant protein

There are no reviews yet.

Be the first to review “Human Intra Acrosomal,SP-10 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products