Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mycobacterium PptT Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mycobacterium
Uniprot ID:
O33336
Molecular weight:
67,08 kDa

Original price was: €267.00.Current price is: €210.00.

50ug 21% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mycobacterium PptT Recombinant Protein

Product name Mycobacterium PptT Recombinant Protein
Uniprot ID O33336
Uniprot link http://www.uniprot.org/uniprot/O33336
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
Molecular weight 67,08 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer Tris 20mM pH7, NaCl 200mM, EDTA 1mM, Maltose 10mM without dialysis. Tris 10mM pH8, NaCl 100mM, glycerol 10% with dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_217310
Spec:Entrez GeneID 13317579, 888226
Spec:SwissProtID O33336
NCBI Reference NP_217310
Aliases /Synonyms MBP-PptT, hypothetical protein Rv2794c
Reference PX-P1124
Note For research use only
Molecular Constructor
Full-length Yes
Product name Mycobacterium PptT Recombinant Protein
Uniprot ID O33336
Uniprot link http://www.uniprot.org/uniprot/O33336
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
Molecular weight 67,08 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer Tris 20mM pH7, NaCl 200mM, EDTA 1mM, Maltose 10mM without dialysis. Tris 10mM pH8, NaCl 100mM, glycerol 10% with dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_217310
Spec:Entrez GeneID 13317579, 888226
Spec:SwissProtID O33336
NCBI Reference NP_217310
Aliases /Synonyms MBP-PptT, hypothetical protein Rv2794c
Reference PX-P1124
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1124-1MG
Uniprot ID O33336
Uniprot link http://www.uniprot.org/uniprot/O33336
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
Molecular weight 67,08 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer Tris 20mM pH7, NaCl 200mM, EDTA 1mM, Maltose 10mM without dialysis. Tris 10mM pH8, NaCl 100mM, glycerol 10% with dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_217310
Spec:Entrez GeneID 13317579, 888226
Spec:SwissProtID O33336
NCBI Reference NP_217310
Aliases /Synonyms MBP-PptT, hypothetical protein Rv2794c
Reference PX-P1124
Note For research use only
Molecular Constructor
Full-length Yes

Mycobacterium PptT Recombinant Protein

There are no reviews yet.

Be the first to review “Mycobacterium PptT Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products