Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade

  • PX-TA2209-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

Product name PX-TA2209-50
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Product name Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Product name Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Title: Introduction to Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb

Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb is a research grade therapeutic antibody that has shown promising results in targeting and inhibiting the growth of hybridoma cells. This biosimilar is a monoclonal antibody that specifically binds to the hybridoma growth factor, effectively blocking its activity and preventing the proliferation of hybridoma cells. In this article, we will delve into the structure, activity, and potential applications of Pacibekitug Biosimilar in scientific research.

Title: Structure of Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb

Pacibekitug Biosimilar is a recombinant monoclonal antibody that is produced using advanced biotechnology techniques. It is a chimeric antibody, meaning it is composed of both human and mouse components. The constant region of the antibody is derived from human immunoglobulin G1 (IgG1), while the variable region is derived from a mouse monoclonal antibody that specifically targets the hybridoma growth factor. This unique structure allows Pacibekitug Biosimilar to effectively bind to the hybridoma growth factor and inhibit its activity.

Title: Activity of Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb

The main activity of Pacibekitug Biosimilar is its ability to bind to the hybridoma growth factor and block its function. The hybridoma growth factor is a cytokine that plays a crucial role in the growth and survival of hybridoma cells. These cells are used in the production of Monoclonal antibody, making the hybridoma growth factor an essential therapeutic target. By binding to the growth factor, Pacibekitug Biosimilar prevents its interaction with its receptor on the surface of hybridoma cells, ultimately leading to the inhibition of cell growth and proliferation.

Title: Applications of Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb

Pacibekitug Biosimilar has shown great potential in various scientific research applications. Its ability to specifically target the hybridoma growth factor makes it a valuable tool in the development of new therapeutic antibodies. By inhibiting the growth of hybridoma cells, this biosimilar can also be used in the production of high-quality Monoclonal antibody. Moreover, Pacibekitug Biosimilar can be used in studies related to hybridoma cell biology and the mechanisms of antibody production.

Title: Therapeutic potential of Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb

The unique structure and activity of Pacibekitug Biosimilar make it a promising candidate for future therapeutic use. Its ability to target and inhibit the hybridoma growth factor could potentially be utilized in the treatment of certain types of cancer, where hybridoma cells play a role in tumor growth. Additionally, Pacibekitug Biosimilar may have therapeutic potential in autoimmune diseases, as the hybridoma growth factor has been implicated in the pathogenesis of these conditions.

Title: Conclusion

In conclusion, Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb is a research grade therapeutic antibody that has shown promising results in targeting and inhibiting the growth of hybridoma cells. Its unique structure and activity make it a valuable tool in scientific research and hold great potential for future therapeutic use. Further studies and clinical trials are needed to fully explore the therapeutic applications of this biosimilar, but its potential to improve the treatment of various diseases is promising.

Pacibekitug Biosimilar - Research Grade in ELISA Assay

Pacibekitug Biosimilar - Research Grade in ELISA Assay

Pacibekitug Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Pacibekitug Biosimilar - Research Grade

SDS-PAGE for Pacibekitug Biosimilar - Research Grade

Pacibekitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products