Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Clazakizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Clazakizumab ELISA Kit

Clazakizumab ELISA Kit

Product name Clazakizumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX149
Note For research use only.
Sample type Plasma, Serum
Target Clazakizumab
Immunogen Clazakizumab

The Structure of Clazakizumab ELISA Kit

Clazakizumab ELISA Kit is a highly specific and sensitive tool for the detection and quantification of clazakizumab, a monoclonal antibody used as a therapeutic agent in the treatment of inflammatory diseases. The kit is designed for use in enzyme-linked immunosorbent assays (ELISAs) and contains all the necessary components for accurate and reproducible measurement of clazakizumab levels in biological samples.

The structure of Clazakizumab ELISA Kit is based on the sandwich ELISA principle, where the target molecule is captured by two specific antibodies, one immobilized on the surface of the microplate and the other conjugated to an enzyme. In this case, the immobilized antibody is specific for clazakizumab and the enzyme-conjugated antibody is specific for a different epitope on the same molecule. This dual binding ensures high specificity and sensitivity of the assay.

The microplate used in the kit is pre-coated with the capture antibody and contains 96 wells, each capable of accommodating a single sample. The kit also includes a standard solution of known clazakizumab concentration, which is used to generate a standard curve for quantification of the target molecule in unknown samples. Other components of the kit include wash buffers, substrate solution, and stop solution, all optimized for use in the ELISA procedure.

The Activity of Clazakizumab ELISA Kit

The activity of Clazakizumab ELISA Kit lies in its ability to accurately and precisely measure the concentration of clazakizumab in a variety of biological samples. This is achieved through the use of highly specific antibodies and optimized assay conditions, which minimize interference from other molecules present in the sample. The kit has been validated for use in serum, plasma, and cell culture supernatants, making it a versatile tool for researchers and clinicians.

The activity of the kit is based on the principle of competitive ELISA, where the amount of enzyme activity is inversely proportional to the concentration of the target molecule in the sample. In the presence of clazakizumab in the sample, the enzyme-conjugated antibody is unable to bind to the immobilized antibody, resulting in a lower signal. This signal is then compared to the standard curve generated using the known concentrations of clazakizumab, allowing for accurate quantification of the target molecule in the sample.

Applications of Clazakizumab ELISA Kit

The primary application of Clazakizumab ELISA Kit is in the measurement of clazakizumab levels in biological samples. This is essential for monitoring the efficacy of the therapeutic agent in patients undergoing treatment for inflammatory diseases such as rheumatoid arthritis and psoriasis. The kit can also be used in pre-clinical studies to assess the pharmacokinetics and pharmacodynamics of clazakizumab and to investigate its mechanism of action.

Additionally, Clazakizumab ELISA Kit can be used in research studies to investigate the role of clazakizumab in various disease processes and to identify potential biomarkers for treatment response. The kit can also be used to measure clazakizumab levels in animal models, providing valuable insights into the in vivo behavior of this therapeutic agent.

In conclusion, Clazakizumab ELISA Kit is a valuable tool for the accurate and sensitive measurement of clazakizumab in biological samples. Its well-validated structure, activity, and applications make it an essential component in the development and monitoring of this therapeutic antibody.

Clazakizumab ELISA Kit

There are no reviews yet.

Be the first to review “Clazakizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products