Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Abiprubart Biosimilar – Anti-Tumor necrosis factor receptor superfamily member 5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade

Product name PX-TA2107-50
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Abiprubart Biosimilar is a novel therapeutic antibody that targets the tumor necrosis factor receptor superfamily member 5 (TNFRSF5), also known as CD40. This biosimilar is a research grade antibody that has shown promising results in pre-clinical studies and has the potential to become a valuable tool for researchers studying the role of CD40 in various diseases.

Structure of Abiprubart Biosimilar

Abiprubart Biosimilar is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is derived from a humanized version of the parent antibody, which reduces the risk of immune reactions in patients receiving the biosimilar. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains contain constant and variable regions, while the light chains only have variable regions. The variable regions of the antibody are responsible for binding to the target protein, CD40.

Activity of Abiprubart Biosimilar

The primary activity of Abiprubart Biosimilar is to bind to CD40, a cell surface receptor that is expressed on various immune cells, including B cells, dendritic cells, and macrophages. CD40 is a key regulator of immune responses and plays a crucial role in the activation and differentiation of B cells. By binding to CD40, Abiprubart Biosimilar blocks the interaction between CD40 and its ligand, CD154, thereby inhibiting downstream signaling pathways and modulating immune responses.

Application of Abiprubart Biosimilar

Abiprubart Biosimilar has potential applications in various diseases where CD40 is implicated. It has been studied in pre-clinical models of autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus, where CD40 plays a critical role in the pathogenesis of these conditions. In these models, Abiprubart Biosimilar has shown to reduce disease severity and improve clinical outcomes. Additionally, CD40 is also involved in the development and progression of certain types of cancer, making Abiprubart Biosimilar a potential therapeutic option for cancer treatment.

Research Grade Antibody

Abiprubart Biosimilar is currently only available as a research grade antibody, meaning it is intended for use in laboratory research and not for clinical use. This allows researchers to study the effects of the biosimilar on CD40 in different disease models and gain a better understanding of its potential therapeutic applications. The research grade status also ensures that the biosimilar is produced and tested under strict quality control measures, ensuring its purity and potency for reliable and reproducible results.

Advantages of Abiprubart Biosimilar

One of the major advantages of Abiprubart Biosimilar is its high specificity and affinity for CD40. This allows for targeted and efficient binding to the receptor, leading to potent inhibition of CD40 signaling. Additionally, as a research grade antibody, Abiprubart Biosimilar can be easily modified and conjugated with other molecules for various research applications, such as imaging or drug delivery.

Conclusion

In summary, Abiprubart Biosimilar is a promising therapeutic antibody that targets CD40, a key regulator of immune responses. Its unique structure and high specificity make it a valuable tool for researchers studying the role of CD40 in various diseases. As a research grade antibody, it has potential applications in autoimmune diseases and cancer, and further studies are needed to explore its full therapeutic potential.

SDS-PAGE for Research Grade Abiprubart

SDS-PAGE for Research Grade Abiprubart

Research Grade Abiprubart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Abiprubart Biosimilar – Anti-Tumor necrosis factor receptor superfamily member 5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products