Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL6 recombinant protein (Met 1~Met212)

  • PX-P5129-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05231
Molecular weight:
24.69 kDa

Original price was: €382.00.Current price is: €294.00.

50ug 23% OFF + 294 loyalty points
Met1–Met212 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL6 recombinant protein (Met 1~Met212)

Product name PX-P5129-100
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His
Product name PX-P5129-1MG
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His
Product name PX-P5129-50
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Immobilized Human IL6 recombinant protein (Met 1~Met212) (cat. No.PX-P5129) at 0.5µg/mL (100µL/well) can bind to Clazakizumab Biosimilar - Anti-IL6 mAb (cat. No.PX-TA1288) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human IL6 recombinant protein (Met 1~Met212)

There are no reviews yet.

Be the first to review “Human IL6 recombinant protein (Met 1~Met212)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products