Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL6, C-His &amp & Avi tag, recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05231
Molecular weight:
16.75 kDa

420.00

100ug + 420 loyalty points
Val30–Met212 amp Avi His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

IL6, C-His &amp & Avi tag, recombinant protein

Product name IL6, C-His & & Avi tag, recombinant protein
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 16.75 kDa
Protein delivered with Tag? C-terminal His & amp & Avi Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val30-Met212
Protein Accession P05231
Reference PX-P5794
Note For research use only
Molecular Constructor
Val30–Met212 amp Avi His

IL6, C-His &amp & Avi tag, recombinant protein

There are no reviews yet.

Be the first to review “IL6, C-His &amp & Avi tag, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products