Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Foravirumab Biosimilar – Anti-RV mAb – Research Grade

  • PX-TA1064-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €244.00.Current price is: €200.00.

100ug 18% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Foravirumab Biosimilar - Anti-RV mAb - Research Grade

Product name Foravirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Foravirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1064-50
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Foravirumab Biosimilar – Anti-RV mAb – Research Grade is a monoclonal antibody (mAb) that specifically targets and neutralizes the respiratory syncytial virus (RSV). RSV is a common virus that causes respiratory infections in infants, young children, and older adults. Foravirumab Biosimilar is a biosimilar version of the original mAb, with similar structure, activity, and applications.

Structure of Foravirumab Biosimilar

Foravirumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL1) and one variable domain (VL). The variable domains are responsible for the specificity of the antibody, as they bind to the target antigen.

Activity of Foravirumab Biosimilar

Foravirumab Biosimilar specifically targets the fusion protein (F protein) of RSV, which is responsible for viral entry into host cells. The F protein is present on the surface of the virus and is essential for viral attachment and fusion with host cells. Foravirumab Biosimilar binds to the F protein, preventing it from interacting with host cells and thereby inhibiting viral entry and replication.

In addition to neutralizing RSV, Foravirumab Biosimilar also has the ability to activate the immune system. It can bind to immune cells, such as natural killer cells and macrophages, and trigger an immune response against the virus. This activity of Foravirumab Biosimilar can help in clearing the virus from the body and providing long-term protection against RSV infections.

Applications of Foravirumab Biosimilar

Foravirumab Biosimilar has multiple potential applications in the field of RSV infections. It can be used as a therapeutic agent for the treatment of RSV infections in high-risk patients, such as infants and older adults. It can also be used as a prophylactic agent to prevent RSV infections in individuals who are at high risk of developing severe symptoms.

Furthermore, Foravirumab Biosimilar can also be used in research and development studies to further understand the mechanism of RSV infection and to develop new treatments and vaccines. Its high specificity and ability to activate the immune system make it a valuable tool for studying RSV and its interactions with the host.

Conclusion

In summary, Foravirumab Biosimilar – Anti-RV mAb – Research Grade is a recombinant humanized monoclonal antibody that specifically targets and neutralizes the respiratory syncytial virus. Its structure, activity, and applications make it a promising therapeutic agent for the treatment and prevention of RSV infections. Its potential to activate the immune system also makes it a valuable tool for research in the field of RSV.

Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Immobilized Rabies virus/RABV G/Glycoprotein recombinant protein (cat. No.PX-P6266) at 0.5µg/mL (100µL/well) can bind Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade (cat. No.PX-TA1064) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.210M.

Foravirumab Biosimilar - Anti-RV mAb - Research Grade

There are no reviews yet.

Be the first to review “Foravirumab Biosimilar – Anti-RV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products