Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Foravirumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Foravirumab ELISA Kit

Foravirumab ELISA Kit

Product name Foravirumab ELISA Kit
Uniprot ID O92284
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX287
Note For research use only.
Sample type Plasma, Serum
Target Foravirumab
Immunogen Foravirumab

Introduction

Foravirumab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of respiratory syncytial virus (RSV) infection. It is a potent and specific inhibitor of RSV, a common cause of respiratory tract infections in infants, young children, and the elderly. Foravirumab is currently undergoing clinical trials as a potential treatment for RSV infection and has shown promising results. The Foravirumab ELISA Kit is a diagnostic tool that allows for the accurate and sensitive detection of Foravirumab levels in patient samples. In this article, we will discuss the structure, activity, and application of the Foravirumab ELISA Kit.

Structure of Foravirumab ELISA Kit

The Foravirumab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes the principle of antigen-antibody binding to detect the presence of Foravirumab in patient samples. The kit contains a microplate coated with a specific capture antibody that is specific for Foravirumab. The capture antibody is immobilized on the surface of the microplate and is able to bind to Foravirumab present in the patient sample.

The kit also contains a detection antibody, which is labeled with an enzyme such as horseradish peroxidase (HRP). This detection antibody is specific for a different epitope on Foravirumab and is able to bind to Foravirumab that has already been captured by the capture antibody. The addition of a substrate for the enzyme results in a color change, which can be measured using a spectrophotometer. The intensity of the color is directly proportional to the amount of Foravirumab present in the sample.

Activity of Foravirumab ELISA Kit

The Foravirumab ELISA Kit is a highly sensitive and specific diagnostic tool for the detection of Foravirumab. It has a detection limit of 0.1 ng/ml, making it capable of detecting even very low levels of Foravirumab in patient samples. The kit has been validated for use with various sample types, including serum, plasma, and cell culture supernatants. The assay is also able to detect Foravirumab in the presence of other monoclonal antibodies, making it a reliable tool for use in clinical settings.

The Foravirumab ELISA Kit has been shown to have a high degree of reproducibility and accuracy, with intra-assay and inter-assay coefficients of variation of less than 10%. This ensures that results obtained using the kit are reliable and consistent.

Application of Foravirumab ELISA Kit

The Foravirumab ELISA Kit has several potential applications in the field of RSV research and treatment. It can be used to monitor Foravirumab levels in patients undergoing treatment with the monoclonal antibody, allowing for the optimization of dosing regimens. The kit can also be used to assess the pharmacokinetics of Foravirumab, providing valuable information on its distribution and elimination from the body.

In addition, the Foravirumab ELISA Kit can be used to screen potential therapeutic agents for RSV infection. By measuring the ability of these agents to inhibit the binding of Foravirumab to RSV, the kit can aid in the identification of novel treatments for this common respiratory infection.

Conclusion

The Foravirumab ELISA Kit is a valuable tool for the detection and quantification of Foravirumab, a monoclonal antibody with potential therapeutic applications for RSV infection. Its high sensitivity, specificity, and reproducibility make it a reliable and accurate diagnostic tool for use in clinical and research settings. As clinical trials for Foravirumab continue, the Foravirumab ELISA Kit will play an important role in monitoring and optimizing its use as a potential treatment for RSV infection.

Foravirumab ELISA Kit

There are no reviews yet.

Be the first to review “Foravirumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products