Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

  • PX-P5667
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04141
Molecular weight:
17.26 kDa

420.00

100ug + 420 loyalty points
Met1–Glu144 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

Product name CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein
Uniprot ID P04141
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Molecular weight 17.26 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu144
Protein Accession P04141
Reference PX-P5667
Note For research use only.
Molecular Constructor
Met1–Glu144 His

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein binds to Lenzilumab Biosimilar - Anti-CSF2 mAb in indirect ELISA assay

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein binds to Lenzilumab Biosimilar - Anti-CSF2 mAb in indirect ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Lenzilumab Biosimilar - Anti-CSF2 mAb (cat. No.PX-TA1360) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 33.07M.

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade (cat. No.PX-TA1141) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 152.1M.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb (cat. No.PX-TA1259) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 34.24M.

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

There are no reviews yet.

Be the first to review “CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products