Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gimsilumab Biosimilar – Anti-CSF2 , GM-CSF mAb – Research Grade

  • PX-TA1478-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade

Product name Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1478-50
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Gimsilumab biosimilar, also known as anti-CSF2, is a monoclonal antibody (mAb) that targets the cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF). This protein plays a crucial role in the immune system by promoting the production and differentiation of white blood cells. Gimsilumab biosimilar is a research-grade version of the original drug, and its structure, activity, and potential applications will be discussed in this article.

Structure of Gimsilumab Biosimilar

Gimsilumab biosimilar is a fully humanized IgG1 monoclonal antibody, meaning that it is made up of human immunoglobulin G1 molecules. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 50 kDa. The antibody has a Y-shaped structure, with two antigen-binding sites located at the tips of the Y. These binding sites are specific for GM-CSF, allowing Gimsilumab biosimilar to bind to and neutralize the cytokine.

Activity of Gimsilumab Biosimilar

Gimsilumab biosimilar works by blocking the activity of GM-CSF, which is known to be involved in the pathogenesis of various inflammatory and autoimmune diseases. By binding to GM-CSF, Gimsilumab biosimilar prevents the cytokine from binding to its receptor on immune cells, thereby inhibiting its signaling pathway. This leads to a decrease in the production and activation of inflammatory cells, ultimately reducing inflammation and tissue damage.

Studies have shown that Gimsilumab biosimilar has a high affinity for GM-CSF, with a dissociation constant (Kd) of 0.7 nM. This indicates that the antibody has a strong binding ability, making it an effective inhibitor of GM-CSF activity. Additionally, Gimsilumab biosimilar has been found to have a long half-life of approximately 21 days, allowing for sustained inhibition of GM-CSF and prolonged therapeutic effects.

Application of Gimsilumab Biosimilar

Gimsilumab biosimilar is currently being investigated for its potential use in the treatment of various inflammatory and autoimmune diseases. These include rheumatoid arthritis, psoriasis, and multiple sclerosis, all of which are characterized by excessive inflammation and immune cell activation. By targeting GM-CSF, Gimsilumab biosimilar has the potential to provide a more targeted and effective treatment option for these conditions.

In addition, Gimsilumab biosimilar has also shown promise in the treatment of COVID-19. Studies have shown that GM-CSF plays a crucial role in the development of cytokine storm, a severe immune response that can lead to respiratory failure and death in COVID-19 patients. By inhibiting GM-CSF, Gimsilumab biosimilar may be able to reduce the severity of cytokine storm and improve outcomes in patients with severe COVID-19.

Conclusion

Gimsilumab biosimilar, also known as anti-CSF2, is a monoclonal antibody that targets the cytokine GM-CSF. Its structure, activity, and potential applications make it a promising therapeutic option for inflammatory and autoimmune diseases, as well as for COVID-19. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but early results are promising and suggest that it may provide a more targeted and effective treatment option for a range of conditions.

SDS-PAGE for Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

SDS-PAGE for Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Gimsilumab Biosimilar – Anti-CSF2 , GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products