Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenzilumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Lenzilumab ELISA Kit

Lenzilumab ELISA Kit

Product name Lenzilumab ELISA Kit
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX140
Note For research use only.
Sample type Plasma, Serum
Target Lenzilumab
Immunogen Lenzilumab

Introduction to Lenzilumab ELISA Kit

The Lenzilumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) designed for the quantitative detection of Lenzilumab in biological samples. Lenzilumab is a humanized monoclonal antibody that targets the soluble form of granulocyte-macrophage colony-stimulating factor (GM-CSF), a cytokine involved in the regulation of immune cell function. This kit provides a quick and reliable method for measuring Lenzilumab levels, making it a valuable tool for research and clinical applications.

Structure of Lenzilumab

Lenzilumab is a recombinant, humanized IgG4 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each consisting of variable and constant regions. The variable region of Lenzilumab is responsible for its specificity and binds to the soluble form of GM-CSF with high affinity. The constant region, on the other hand, is responsible for effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The humanization of Lenzilumab involves replacing the murine sequences in the variable regions with human sequences to reduce the risk of immunogenicity and increase its half-life in the body. This makes Lenzilumab a safe and effective therapeutic agent for targeting GM-CSF in various diseases.

Mechanism of Action

GM-CSF is a potent cytokine that plays a crucial role in the regulation of immune cell function. It is involved in the differentiation, proliferation, and survival of various immune cells, including macrophages, neutrophils, and dendritic cells. However, excessive production of GM-CSF has been linked to several inflammatory and autoimmune diseases, making it an attractive therapeutic target.

Lenzilumab binds to the soluble form of GM-CSF, preventing it from binding to its receptor and activating downstream signaling pathways. This blocks the pro-inflammatory effects of GM-CSF and reduces the recruitment and activation of immune cells. Lenzilumab also promotes the clearance of GM-CSF by binding to it and facilitating its degradation, further reducing its levels in the body.

Applications of Lenzilumab ELISA Kit

The Lenzilumab ELISA Kit has various applications in both research and clinical settings. In research, it can be used to measure Lenzilumab levels in biological samples, such as serum, plasma, and cell culture supernatants. This allows for the monitoring of Lenzilumab pharmacokinetics and the evaluation of its efficacy in preclinical and clinical studies.

In the clinical setting, the Lenzilumab ELISA Kit can be used for patient screening, diagnosis, and monitoring of Lenzilumab therapy. Elevated levels of Lenzilumab in the blood may indicate a good response to treatment, while low levels may suggest the need for dose adjustment or treatment discontinuation. This kit can also be used to assess the presence of anti-Lenzilumab antibodies, which may affect the drug’s efficacy and safety.

Conclusion

The Lenzilumab ELISA Kit is a valuable tool for the quantitative detection of Lenzilumab in biological samples. It provides a quick, sensitive, and specific method for measuring Lenzilumab levels, making it an essential tool for research and clinical applications. With its ability to target GM-CSF, Lenzilumab has shown promising results in various diseases, and the Lenzilumab ELISA Kit plays a crucial role in its development and use as a therapeutic agent.

Keywords: Lenzilumab, ELISA Kit, antibody, therapeutic target, GM-CSF, cytokine, immune cells,

Lenzilumab ELISA Kit

There are no reviews yet.

Be the first to review “Lenzilumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products