Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vobramitamab Biosimilar – Anti-CD276 mAb – Research Grade

  • PX-TA1890-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

Product name Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1890-50
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Vobramitamab Biosimilar – Anti-CD276 mAb

Vobramitamab Biosimilar – Anti-CD276 mAb, also known as BAVENCIO, is a monoclonal antibody that targets CD276, a protein found on the surface of cancer cells. This biosimilar is a research grade version of the original drug, and is used for scientific and pre-clinical studies.

Structure of Vobramitamab Biosimilar – Anti-CD276 mAb

Vobramitamab Biosimilar – Anti-CD276 mAb is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a structure similar to natural antibodies produced by the immune system. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions are responsible for binding to the CD276 protein, while the constant regions provide stability and effector functions.

Mechanism of Action

Vobramitamab Biosimilar – Anti-CD276 mAb works by binding to CD276 on the surface of cancer cells, which leads to the activation of the immune system. This activation triggers a series of events that result in the destruction of cancer cells. Additionally, the antibody can also block the interaction between CD276 and its receptors, inhibiting the growth and survival of cancer cells.

Title: Therapeutic Applications

Vobramitamab Biosimilar – Anti-CD276 mAb has shown promising results in pre-clinical studies for the treatment of various types of cancer, including breast, lung, ovarian, and bladder cancer. It has also been studied in combination with other cancer therapies, such as chemotherapy and radiation, and has shown synergistic effects. This biosimilar is currently being evaluated in clinical trials for its potential as a targeted therapy for cancer.

Advantages of Vobramitamab Biosimilar – Anti-CD276 mAb

One of the main advantages of Vobramitamab Biosimilar – Anti-CD276 mAb is its specificity for CD276, which minimizes off-target effects and reduces the risk of adverse reactions. As a fully humanized antibody, it also has a lower risk of immune response and can be administered repeatedly without losing its efficacy. Additionally, this biosimilar is produced using advanced biotechnology methods, ensuring high purity and consistency.

Title: Research Grade Use

Vobramitamab Biosimilar – Anti-CD276 mAb is primarily used as a research tool for the study of CD276 and its role in cancer. It can be used in various in vitro and in vivo experiments to investigate the mechanism of action and potential therapeutic applications of targeting CD276. This biosimilar is also useful for the development and optimization of diagnostic assays for CD276 expression in cancer cells.

Conclusion

In summary, Vobramitamab Biosimilar – Anti-CD276 mAb is a promising monoclonal antibody with potential therapeutic applications in cancer treatment. Its specific targeting of CD276 and minimal side effects make it a valuable research tool for the study of this protein and its role in cancer. As more clinical trials are conducted, this biosimilar has the potential to become a valuable addition to the arsenal of cancer therapies.

SDS-PAGE for Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

SDS-PAGE for Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA Assay

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA Assay

CD276 Recombinant Protein(cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vobramitamab Biosimilar – Anti-CD276 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products