Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enoblituzumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Enoblituzumab ELISA Kit

Enoblituzumab ELISA Kit

Product name Enoblituzumab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX265
Note For research use only.
Sample type Plasma, Serum
Target Enoblituzumab
Immunogen Enoblituzumab

Introduction

Enoblituzumab is a monoclonal antibody that has shown promising results in the treatment of various types of cancer. It specifically targets the immune checkpoint protein, programmed cell death protein 1 (PD-1), which is known to play a crucial role in suppressing the immune response against cancer cells. The detection and quantification of enoblituzumab in biological samples is essential for monitoring its therapeutic efficacy. This is where the Enoblituzumab ELISA Kit comes into play.

Structure of Enoblituzumab

Enoblituzumab is a humanized IgG1 monoclonal antibody, meaning that it is composed of human antibody sequences with a small portion of non-human sequences. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of constant and variable regions, while the light chains only have variable regions. The variable regions are responsible for binding to the target protein, PD-1.

Activity of Enoblituzumab

Enoblituzumab binds to PD-1 with high affinity and specificity, preventing its interaction with its ligands, PD-L1 and PD-L2. This interaction between PD-1 and its ligands is known to inhibit the function of T cells, which are responsible for killing cancer cells. By blocking this interaction, enoblituzumab enhances the anti-tumor immune response, leading to the destruction of cancer cells.

Application of Enoblituzumab ELISA Kit

The Enoblituzumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of enoblituzumab in biological samples, such as serum, plasma, and cell culture supernatants. This kit utilizes the sandwich ELISA technique, where the target protein is captured by a specific antibody coated on the surface of a microplate and then detected by a secondary antibody labeled with an enzyme. The enzyme catalyzes a colorimetric or chemiluminescent reaction, which can be measured using a spectrophotometer or luminometer, respectively.

The Enoblituzumab ELISA Kit has a wide dynamic range, allowing for the accurate measurement of enoblituzumab at different concentrations. It also has a low limit of detection, making it suitable for monitoring the levels of enoblituzumab in patients receiving treatment. This kit is user-friendly, with a simple and fast protocol, and can be used in most laboratory settings.

Conclusion

Enoblituzumab is a promising therapeutic antibody that targets PD-1 and enhances the anti-tumor immune response. The Enoblituzumab ELISA Kit is an essential tool for the detection and quantification of enoblituzumab in biological samples, allowing for the monitoring of its therapeutic efficacy. With its high sensitivity, specificity, and user-friendly protocol, this kit is a valuable asset in the development and clinical use of enoblituzumab as a cancer treatment.

Enoblituzumab ELISA Kit

There are no reviews yet.

Be the first to review “Enoblituzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products