Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atidortoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Atidortoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Staphylococcus aureus Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Staphylococcus aureus Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1485-50
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Atidortoxumab Biosimilar: A Promising Anti-Alpha Toxin Monoclonal Antibody for Therapeutic Applications Atidortoxumab Biosimilar, also known as anti-alpha toxin mAb, is a research grade monoclonal antibody that has shown promising potential as a therapeutic agent for a variety of diseases. This biosimilar is a highly specific antibody that targets the alpha toxin, a virulence factor produced by various bacterial pathogens.

Structure of Atidortoxumab Biosimilar

Atidortoxumab Biosimilar is a recombinant humanized monoclonal antibody that is structurally similar to the original Atidortoxumab. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure, with the antigen-binding sites located at the tips of the arms.

The variable regions of the antibody, also known as the antigen-binding regions, are responsible for the specificity of Atidortoxumab Biosimilar towards the alpha toxin. These regions are highly diverse and are generated through genetic recombination during the development of B-cells. The constant regions of the antibody, on the other hand, are responsible for the effector functions of the antibody, such as binding to immune cells and activating the complement system.

Mechanism of Action

Atidortoxumab Biosimilar exerts its therapeutic effects by binding to the alpha toxin produced by bacterial pathogens. This binding prevents the toxin from interacting with its target cells and inhibits its cytotoxic activity. Additionally, the binding of the antibody to the toxin also triggers the immune system to recognize and eliminate the toxin, further enhancing its efficacy.

Moreover, Atidortoxumab Biosimilar can also activate the complement system, a part of the immune system that helps in the clearance of pathogens. This activation leads to the formation of membrane attack complexes that can directly lyse bacterial cells, providing an additional mechanism of action for the antibody.

Applications of Atidortoxumab Biosimilar

Atidortoxumab Biosimilar has been studied for its therapeutic potential in various diseases caused by bacterial pathogens that produce the alpha toxin. Some of the notable applications of this antibody include:

1. Treatment of Staphylococcus aureus infections Staphylococcus aureus is a common bacterial pathogen that produces the alpha toxin, which is responsible for the development of severe skin and soft tissue infections. Atidortoxumab Biosimilar has shown promising results in preclinical studies as a potential treatment for these infections. It has been found to effectively neutralize the alpha toxin and inhibit its cytotoxic effects, leading to improved outcomes in animal models.

2. Prevention of Clostridium perfringens infections Clostridium perfringens is a bacterium that produces the alpha toxin, which is responsible for the development of gas gangrene and food poisoning. Atidortoxumab Biosimilar has been shown to effectively neutralize the alpha toxin and prevent its cytotoxic effects, making it a potential preventive measure against these infections.

3. Treatment of necrotizing fasciitis Necrotizing fasciitis is a severe and potentially life-threatening infection caused by bacterial pathogens, including Streptococcus pyogenes, which produce the alpha toxin. Atidortoxumab Biosimilar has shown promising results in preclinical studies as a potential treatment for this infection. It has been found to effectively neutralize the alpha toxin and reduce tissue damage, leading to improved outcomes in animal models.

4. Management of sepsis Sepsis is a life-threatening condition caused by an overwhelming immune response to an infection. Bacterial

Atidortoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Atidortoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products