Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Tumor necrosis factor(TNF)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Tumor necrosis factor(TNF) |
|---|---|
| Uniprot ID | P51742 |
| Uniprot link | http://www.uniprot.org/uniprot/P51742 |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Val77-Leu233 |
| Aliases /Synonyms | Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a,TNFA, TNFSF2 |
| Reference | PX-P4641 |
| Note | For research use only |
Description of Tumor necrosis factor(TNF)
General Information about Tumor necrosis factor (TNF)
Tumor necrosis factor (TNF, cachexia or cachexia protein
Related products
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.