Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Tumor necrosis factor(TNF) |
---|---|
Uniprot ID | P51742 |
Uniprot link | http://www.uniprot.org/uniprot/P51742 |
Expression system | Eukaryotic expression |
Sequence | MGSHHHHHHSGVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL |
Purity estimated | >90%by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Val77-Leu233 |
Aliases /Synonyms | Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a,TNFA, TNFSF2 |
Reference | PX-P4641 |
Note | For research use only |
Tumor necrosis factor (TNF, cachexia or cachexia protein
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.