Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade

  • PX-TA1178-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade

Product name Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1178-50
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade: A Potent Antibody Targeting CD30 for Therapeutic Applications

Introduction

Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade is a promising monoclonal antibody (mAb) that specifically targets CD30, a member of the tumor necrosis factor receptor (TNFR) superfamily. This biosimilar is a highly effective and safe therapeutic option for treating CD30-positive malignancies, such as Hodgkin’s lymphoma and anaplastic large cell lymphoma. In this article, we will delve into the structure, activity, and potential applications of Iratumumab Biosimilar, highlighting its potential as a valuable tool in the fight against cancer.

Structure of Iratumumab Biosimilar

Iratumumab Biosimilar is a recombinant, chimeric IgG1 mAb composed of human and murine antibody sequences. It consists of two heavy chains and two light chains, each containing a variable and constant region. The variable region is responsible for binding to CD30, while the constant region determines the antibody’s effector functions. The mAb has a molecular weight of approximately 150 kDa and a half-life of 21 days, making it suitable for therapeutic use.

Activity of Iratumumab Biosimilar

CD30 is a cell surface protein that is highly expressed on the surface of malignant cells in various lymphomas and leukemias. It is also present on activated T and B cells, making it an attractive target for cancer therapy. Iratumumab Biosimilar specifically binds to CD30, leading to its internalization and subsequent cell death through various mechanisms, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This targeted approach minimizes off-target effects and enhances the overall efficacy of the treatment.

Potential Applications of Iratumumab Biosimilar

Hodgkin’s lymphoma and anaplastic large cell lymphoma (ALCL) are two types of malignancies that highly express CD30. These diseases are associated with poor prognosis and limited treatment options, making Iratumumab Biosimilar a much-needed therapeutic option. Clinical trials have shown promising results, with a high response rate and manageable side effects in patients with relapsed or refractory CD30-positive lymphomas. Furthermore, the biosimilar has also shown potential in combination with other chemotherapeutic agents, further improving treatment outcomes.

In addition to its potential in lymphomas, Iratumumab Biosimilar has also shown promise in the treatment of other CD30-positive malignancies, such as cutaneous T-cell lymphoma and primary mediastinal B-cell lymphoma. The mAb has also been investigated for its potential in the prevention of relapse in patients undergoing stem cell transplantation for Hodgkin’s lymphoma. These studies have demonstrated the potential of Iratumumab Biosimilar as a versatile therapeutic agent in various CD30-positive cancers.

Conclusion

Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade is a highly effective and safe therapeutic option for treating CD30-positive malignancies. Its specific binding to CD30 and subsequent cell death make it a potent tool in the fight against cancer. With its promising results in clinical trials and potential applications in various CD30-positive cancers, this biosimilar has the potential to improve treatment outcomes and enhance the quality of life for patients. Further research and development in this field will undoubtedly uncover more potential applications for Iratumumab Biosimilar, making it an invaluable asset in the field of cancer therapy.

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow-cytometry using FITC anti-human CD30 antibody. Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD30 monoclonal antibody (Catalog: PX-TA1178, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow-cytometry using APC anti-human CD30 antibody. Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD30 monoclonal antibody (Catalog: PX-TA1178, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade in ELISA Assay

Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade in ELISA Assay

Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

SDS-PAGE for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products