Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Thrombomodulin (THBD)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P07204
Molecular weight:
25.61kDa

210.00

50ug + 210 loyalty points
Pro19–Asp245
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Thrombomodulin (THBD)

Product name Thrombomodulin (THBD)
Uniprot ID P07204
Uniprot link https://www.uniprot.org/uniprot/P07204
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWD
Molecular weight 25.61kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro19-Asp245
Aliases /Synonyms Thrombomodulin, TM, Fetomodulin, CD_antigen: CD141
Reference PX-P4369
Note For research use only
Molecular Constructor
Pro19–Asp245
Product name Thrombomodulin (THBD)
Uniprot ID P07204
Uniprot link https://www.uniprot.org/uniprot/P07204
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWD
Molecular weight 25.61kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro19-Asp245
Aliases /Synonyms Thrombomodulin, TM, Fetomodulin, CD_antigen: CD141
Reference PX-P4369
Note For research use only
Molecular Constructor
Pro19–Asp245

There are no reviews yet.

Be the first to review “Thrombomodulin (THBD)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products