Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Relfovetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €254.00.Current price is: €200.00.

100ug 21% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

Product name Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Relfovetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1569-50
Uniprot ID Q6ZY27
Source CAS 2171034-70-9
Species Felinized
Expression system Mammalian cells
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Relfovetmab ,ZTS-00084768,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1569
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: Relfovetmab Biosimilar: A Promising Antibody for Targeting NGF in Therapeutic Applications

Introduction:

Relfovetmab Biosimilar is a novel monoclonal antibody (mAb) that targets nerve growth factor (NGF) and has shown great potential in various therapeutic applications. This biosimilar is designed to mimic the activity of NGF and has been extensively studied for its structure, activity, and potential applications in the field of medicine. In this article, we will discuss the structure, activity, and applications of Relfovetmab Biosimilar in detail.

Structure of Relfovetmab Biosimilar:

Relfovetmab Biosimilar is a fully humanized IgG1 monoclonal antibody that specifically binds to NGF. It is a biosimilar of the currently approved anti-NGF mAb, tanezumab. The antibody consists of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of Relfovetmab Biosimilar is responsible for its specificity towards NGF, while the constant region provides stability and effector functions.

Activity of Relfovetmab Biosimilar:

Relfovetmab Biosimilar exerts its activity by binding to NGF and inhibiting its interaction with its receptors, TrkA and p75. This prevents the activation of downstream signaling pathways, including the mitogen-activated protein kinase (MAPK) and phosphoinositide 3-kinase (PI3K) pathways, which are involved in pain and inflammation. By blocking NGF, Relfovetmab Biosimilar can reduce pain and inflammation associated with various conditions, such as osteoarthritis, chronic low back pain, and cancer.

Applications of Relfovetmab Biosimilar:

Relfovetmab Biosimilar has shown promising results in various preclinical and clinical studies, making it a potential candidate for therapeutic applications. Some of its potential applications include:

1. Pain Management:

As NGF is a key mediator of pain, Relfovetmab Biosimilar has been studied for its potential in managing various types of pain, including osteoarthritis, chronic low back pain, and cancer pain. In a phase II clinical trial, Relfovetmab Biosimilar showed significant improvement in pain relief and physical function in patients with osteoarthritis.

2. Inflammatory Diseases:

NGF has been implicated in the pathogenesis of various inflammatory diseases, such as rheumatoid arthritis, psoriasis, and asthma. Relfovetmab Biosimilar has shown promising results in preclinical studies for these conditions and is currently being evaluated in clinical trials.

3.

Cancer:

NGF has been shown to promote tumor growth and metastasis in various types of cancer. Relfovetmab Biosimilar has been studied for its potential in inhibiting tumor growth and reducing pain associated with cancer. In a phase II clinical trial, Relfovetmab Biosimilar showed promising results in patients with advanced pancreatic cancer.

4. Neurological Disorders:

NGF plays a crucial role in the development and maintenance of the nervous system. Dysregulation of NGF has been linked to various neurological disorders, such as Alzheimer’s disease, Parkinson’s disease, and multiple sclerosis. Relfovetmab Biosimilar has shown potential in improving cognitive function and reducing neuroinflammation in preclinical studies.

Conclusion:

Relfovetmab Biosimilar is a promising antibody that targets NGF and has shown potential in various therapeutic applications. Its structure and activity make it a potent inhibitor of NGF, and its potential applications include pain management, inflammatory diseases, cancer, and neurological disorders. Further clinical studies are needed to fully explore the therapeutic potential of Relfovetmab Biosimilar and bring it to the market as a viable treatment option for various conditions.

SDS-PAGE for Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

SDS-PAGE for Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

Relfovetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Relfovetmab  Biosimilar - Anti-NGF, NGFB mAb - Research Grade

There are no reviews yet.

Be the first to review “Relfovetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products