Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Setrusumab Biosimilar – Anti-SOST mAb – Research Grade

  • PX-TA1430-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
SEC-HPLC of Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Product name Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1430-50
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

General information on Anti-SOST[Homo sapiens] (Setrusumab) Monoclonal Antibody

Setrusumab is investigated to treat Post Menopausal Women with low Bone Mineral Density.

SDS-PAGE for Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

SDS-PAGE for Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

SEC-HPLC of Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Setrusumab Biosimilar - Anti-SOST mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

There are no reviews yet.

Be the first to review “Setrusumab Biosimilar – Anti-SOST mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products