Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sclerostin (SOST )

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9BQB4

Original price was: €217.00.Current price is: €182.00.

50ug 16% OFF + 182 loyalty points
Gln24–Tyr213
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sclerostin (SOST )

Product name Sclerostin (SOST )
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213
Product name Sclerostin (SOST )
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213
Product name PX-P4621-1MG
Uniprot ID Q9BQB4
Uniprot link http://www.uniprot.org/uniprot/Q9BQB4
Expression system Prokaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Purity estimated >40%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P4621
Note For research use only
Molecular Constructor
Gln24–Tyr213

General Information about Sclerostin (SOST)

Sclerostin is a protein encoded by the SOST gene in humans. Sclerostin is a secreted glycoprotein with a C-terminal cysteine ​​knot-like (CTCK) domain, and its sequence is different from that of the bone morphogenetic protein (BMP) antagonist DAN (differential selection gene in neuroblastoma) . Sclerostin is mainly produced by bone cells, but it can also be expressed in other tissues and has an anti-anabolic effect on bone formation.

Sclerostin (SOST )

There are no reviews yet.

Be the first to review “Sclerostin (SOST )”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products