Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brazikumab Biosimilar – Anti-IL23A mAb – Research Grade

  • PX-TA1449-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1449-50
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

Introduction

Brazikumab Biosimilar is a novel monoclonal antibody (mAb) that targets the interleukin-23A (IL-23A) cytokine, which plays a critical role in the pathogenesis of various autoimmune and inflammatory diseases. This biosimilar is a research grade version of the original Brazikumab, which has been approved for the treatment of moderate to severe Crohn’s disease and ulcerative colitis. In this article, we will discuss the structure, activity, and potential applications of Brazikumab Biosimilar as a therapeutic antibody.

Structure of Brazikumab Biosimilar

Brazikumab Biosimilar is a fully humanized IgG1 monoclonal antibody, which means it is derived from human cells and has a structure similar to that of the natural human antibodies. It is composed of two heavy chains and two light chains, each of which contains a variable region and a constant region. The variable region is responsible for binding to the IL-23A cytokine, while the constant region is responsible for effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Brazikumab Biosimilar

The primary activity of Brazikumab Biosimilar is to bind specifically to the IL-23A cytokine and block its interaction with its receptor, IL-23R. This prevents the downstream signaling pathways that lead to the production of pro-inflammatory cytokines, such as IL-17 and IL-22, which are involved in the development of autoimmune and inflammatory diseases. By inhibiting the IL-23A/IL-23R pathway, Brazikumab Biosimilar effectively suppresses the immune response, reducing inflammation and tissue damage.

Potential Applications of Brazikumab Biosimilar

Brazikumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various autoimmune and inflammatory diseases. Its potential applications include:

1. Inflammatory Bowel Disease (IBD): IBD is a chronic inflammatory disorder of the gastrointestinal tract, which includes Crohn’s disease and ulcerative colitis. Brazikumab Biosimilar has been shown to be effective in reducing the symptoms of IBD, such as abdominal pain, diarrhea, and rectal bleeding.

2. Psoriasis: Psoriasis is a chronic inflammatory skin disease characterized by red, scaly patches on the skin. IL-23A has been identified as a key cytokine in the development of psoriasis, and Brazikumab Biosimilar has shown promising results in clinical trials for the treatment of this condition.

3. Rheumatoid Arthritis (RA): RA is a chronic autoimmune disease that causes inflammation and damage to the joints. IL-23A has been implicated in the pathogenesis of RA, and Brazikumab Biosimilar has shown potential as a therapeutic option for this condition.

4. Ankylosing Spondylitis (AS): AS is a chronic inflammatory disease that primarily affects the spine and sacroiliac joints. IL-23A has been identified as a key cytokine in the development of AS, and Brazikumab Biosimilar has shown efficacy in reducing disease activity and improving symptoms in clinical trials.

Conclusion

In conclusion, Brazikumab Biosimilar is a novel monoclonal antibody that targets the IL-23A cytokine and has potential as a therapeutic option for various autoimmune and inflammatory diseases. Its structure, activity, and potential applications make it a promising candidate for further research and development. As more studies are conducted, Brazikumab Biosimilar may prove to be a valuable addition to the existing treatment options for these diseases.

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade binds to Human IL23A recombinant protein in ELISA Assay

Human IL23A recombinant protein(cat. No.PX-P5123) at 0.5µg/mL (100µL/well) can bind Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Brazikumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products