Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade

  • PX-TA1582-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

Product name Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1582-50
Uniprot ID P10646
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

Introduction

Befovacimab Biosimilar, also known as Anti-TFPI mAb, is a monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody Befovacimab. This biosimilar has been designed to target the protein Tissue Factor Pathway Inhibitor (TFPI), which plays a crucial role in the regulation of blood coagulation. In this article, we will discuss the structure, activity, and potential applications of Befovacimab Biosimilar.

Structure of Befovacimab Biosimilar

Befovacimab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced by genetically engineering human DNA into a non-human host, such as bacteria or mammalian cells. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of one constant region (CL) and one variable region (VL). The variable regions of the heavy and light chains are responsible for binding to the target protein, TFPI.

Activity of Befovacimab Biosimilar

Befovacimab Biosimilar specifically targets TFPI, a protein that is involved in the regulation of blood coagulation. TFPI inhibits the activity of Factor Xa, a key enzyme in the coagulation cascade. By binding to TFPI, Befovacimab Biosimilar blocks its inhibitory activity, leading to increased levels of Factor Xa and promoting blood coagulation. This mechanism of action makes Befovacimab Biosimilar a potential therapeutic option for conditions associated with abnormal blood coagulation, such as thrombosis and hemophilia.

Applications of Befovacimab Biosimilar

Befovacimab Biosimilar has the potential to be used in a variety of medical conditions where abnormal blood coagulation is a concern. One of the main applications of this biosimilar is in the treatment of thrombotic disorders, such as deep vein thrombosis and pulmonary embolism. By inhibiting TFPI, Befovacimab Biosimilar can help prevent the formation of blood clots and reduce the risk of these life-threatening conditions.

Another potential application of Befovacimab Biosimilar is in the treatment of hemophilia, a genetic disorder characterized by a deficiency in clotting factors. By promoting blood coagulation, Befovacimab Biosimilar can help control bleeding episodes in hemophilia patients. This biosimilar may also be used as a prophylactic treatment to prevent bleeding episodes in patients with severe hemophilia.

In addition to its potential therapeutic applications, Befovacimab Biosimilar can also be used as a research tool for studying the role of TFPI in various diseases. By blocking the inhibitory activity of TFPI, researchers can investigate the effects of increased Factor Xa levels on blood coagulation and other physiological processes.

Conclusion

In summary, Befovacimab Biosimilar is a recombinant humanized monoclonal antibody that targets the protein TFPI. By blocking the inhibitory activity of TFPI, this biosimilar promotes blood coagulation and has the potential to be used in the treatment of thrombotic disorders and hemophilia. It can also serve as a valuable research tool for studying the role of TFPI in various diseases. With its unique structure and targeted activity, Befovacimab Biosimilar holds promise as a potential therapeutic option for conditions associated with abnormal blood coagulation.

SEC-HPLC of Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

SEC-HPLC of Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

Befovacimab Biosimilar - Anti-TFPI mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Befovacimab  Biosimilar - Anti-TFPI  mAb - Research Grade

There are no reviews yet.

Be the first to review “Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products