Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Blosozumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Blosozumab ELISA Kit

Blosozumab ELISA Kit

Product name Blosozumab ELISA Kit
Uniprot ID Q9BQB4
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX274
Note For research use only.
Sample type Plasma, Serum
Target Blosozumab
Immunogen Blosozumab

Title: Understanding the Structure and Function of Blosozumab ELISA Kit: A Revolutionary Tool for Antibody Detection

Introduction:

Blosozumab ELISA Kit is a cutting-edge diagnostic tool that has revolutionized the field of antibody detection. This innovative kit has been developed to accurately detect and quantify the levels of blosozumab, a monoclonal antibody used as a therapeutic target for various diseases. In this article, we will delve into the structure, activity and application of this ELISA kit, and highlight its significance in the scientific community.

Structure of Blosozumab ELISA Kit:

The Blosozumab ELISA Kit is composed of several components, each playing a crucial role in the detection process. The kit contains a microplate coated with a specific antibody that binds to blosozumab with high affinity. This immobilized antibody acts as a capture agent, capturing blosozumab from the sample being tested. The kit also contains a detection antibody, which is labeled with an enzyme such as horseradish peroxidase (HRP). This detection antibody binds to the captured blosozumab, forming a sandwich complex. The kit also includes a substrate solution that reacts with the enzyme to produce a colorimetric signal, which is directly proportional to the amount of blosozumab present in the sample.

Activity of Blosozumab ELISA Kit:

The Blosozumab ELISA Kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to accurately detect the presence of blosozumab. ELISA is a highly sensitive and specific immunoassay technique that involves the use of antibodies to detect and quantify a specific antigen. In this case, the kit uses two different antibodies, one as a capture agent and the other as a detection agent, to create a sandwich complex with blosozumab. This results in a highly sensitive and specific detection of blosozumab, with a detection limit as low as 0.1 ng/mL. The colorimetric signal produced by the enzyme-substrate reaction is measured using a microplate reader, providing a quantitative analysis of blosozumab levels in the sample.

Application of Blosozumab ELISA Kit:

The Blosozumab ELISA Kit has a wide range of applications in the field of antibody detection. It is primarily used in research and clinical settings to detect and quantify blosozumab levels in various biological samples, such as serum, plasma, and cell culture supernatants. This kit has been particularly useful in monitoring the levels of blosozumab in patients undergoing treatment with this monoclonal antibody. It has also been used to study the pharmacokinetics of blosozumab and its efficacy in different therapeutic settings. Additionally, the Blosozumab ELISA Kit has been instrumental in the development and optimization of blosozumab-based therapies, providing crucial data on the levels of this therapeutic antibody in different biological samples.

Conclusion:

In conclusion, the Blosozumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of blosozumab. Its unique structure and activity make it an indispensable tool for researchers and clinicians working with this therapeutic antibody. With its wide range of applications and accurate results, the Blosozumab ELISA Kit has become an essential component in the study and development of blosozumab-based therapies.

Blosozumab ELISA Kit

There are no reviews yet.

Be the first to review “Blosozumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products