Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Omburtamab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Omburtamab ELISA Kit

Omburtamab ELISA Kit

Product name Omburtamab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX267
Note For research use only.
Sample type Plasma, Serum
Target Omburtamab
Immunogen Omburtamab

The Structure and Function of Omburtamab ELISA Kit: A Powerful Tool for Detecting and Studying Omburtamab Antibody

The Basics of Omburtamab ELISA Kit

Omburtamab ELISA Kit is a powerful and versatile tool used in the field of immunology for detecting and quantifying Omburtamab antibody in biological samples. This kit utilizes the enzyme-linked immunosorbent assay (ELISA) technique, which is a widely used method for detecting and measuring the presence of specific antibodies in a sample.

The Structure of Omburtamab ELISA Kit

The Omburtamab ELISA Kit is composed of several components including microtiter plates, Omburtamab antibody, enzyme-conjugated secondary antibody, substrate solution, and stop solution. The microtiter plates are coated with a specific antigen that binds to the Omburtamab antibody present in the sample. The enzyme-conjugated secondary antibody binds to the Omburtamab antibody, and the substrate solution produces a color change in the presence of the enzyme, which can be measured using a spectrophotometer.

The Activity of Omburtamab ELISA Kit

The Omburtamab ELISA Kit is a highly sensitive and specific tool for detecting and quantifying Omburtamab antibody in various biological samples. The kit is based on the principle of antigen-antibody interaction, where the Omburtamab antibody present in the sample binds to the specific antigen coated on the microtiter plate. The enzyme-conjugated secondary antibody then binds to the Omburtamab antibody, and the substrate solution produces a color change, which is directly proportional to the amount of Omburtamab antibody present in the sample. This color change can be measured using a spectrophotometer, providing a quantitative measurement of the Omburtamab antibody in the sample.

The Application of Omburtamab ELISA Kit

Omburtamab ELISA Kit has a wide range of applications in the field of immunology, particularly in the study of Omburtamab antibody. This kit can be used to detect and quantify Omburtamab antibody in various biological samples, including serum, plasma, and cell culture supernatant. It is also a useful tool for monitoring the levels of Omburtamab antibody in patients undergoing immunotherapy with Omburtamab, a monoclonal antibody used in the treatment of neuroblastoma.

The Omburtamab ELISA Kit is also used in research studies to investigate the role of Omburtamab antibody in various diseases and conditions. This kit can help researchers understand the mechanism of action of Omburtamab and its potential therapeutic effects. Additionally, the Omburtamab ELISA Kit can be used to screen potential therapeutic agents that target Omburtamab antibody, aiding in the development of new treatments for diseases associated with Omburtamab.

The Advantages of Omburtamab ELISA Kit

The Omburtamab ELISA Kit offers several advantages over other methods of detecting and quantifying Omburtamab antibody. It is a simple, rapid, and cost-effective method that can be easily performed in a laboratory setting. The kit also has a high sensitivity and specificity, allowing for accurate and reliable results. Furthermore, the Omburtamab ELISA Kit can process a large number of samples simultaneously, making it a valuable tool for high-throughput studies.

Conclusion

Omburtamab ELISA Kit is a powerful and versatile tool for detecting and quantifying Omburtamab antibody in various biological samples. Its simple and efficient design, along with its high sensitivity and specificity, makes it a valuable tool for researchers and clinicians alike. With the increasing use of Omburtamab in immunotherapy, the

Omburtamab ELISA Kit

There are no reviews yet.

Be the first to review “Omburtamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products