Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nezastomig Biosimilar – Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €262.00.Current price is: €200.00.

100ug 24% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade

Product name PX-TA2129-50
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade
Uniprot ID Q04609 & P10747
Source CAS: 2657613-60-8
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2129
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb is a research grade monoclonal antibody that targets the T-cell-specific surface glycoprotein CD28. This biosimilar is a highly specific and potent antibody that has been developed for use in research and potentially in therapeutic applications.

Structure of Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb is a recombinant monoclonal antibody that is produced using advanced genetic engineering techniques. It is a fully humanized antibody, meaning that it is derived from human cells and has a structure that closely resembles natural antibodies found in the human body.

The antibody has a Y-shaped structure, with two identical light chains and two identical heavy chains. These chains are connected by disulfide bonds and contain specific regions known as variable regions, which are responsible for binding to the target molecule, CD28. The constant regions of the antibody are responsible for mediating effector functions, such as activating immune cells.

Activity of Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb specifically targets the T-cell-specific surface glycoprotein CD28, which is found on the surface of T-cells. CD28 is a co-stimulatory molecule that plays a crucial role in the activation and proliferation of T-cells.

When Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb binds to CD28, it prevents the interaction of CD28 with its ligands, CD80 and CD86. This results in the inhibition of T-cell activation and proliferation, which can be beneficial in certain disease conditions.

Application of Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb has a wide range of potential applications in the field of immunology and oncology research. Its ability to specifically target CD28 makes it a valuable tool for studying the role of CD28 in T-cell activation and proliferation.

Additionally, Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb has potential therapeutic applications in diseases where T-cell activation and proliferation are involved, such as autoimmune diseases and certain types of cancer. By inhibiting CD28, the antibody can potentially modulate the immune response and provide therapeutic benefits.

Conclusion

In conclusion, Nezastomig Biosimilar – Anti-NAALAD1, T-cell-specific surface glycoprotein CD28 mAb is a highly specific and potent antibody that targets the T-cell-specific surface glycoprotein CD28. Its structure, activity, and potential applications make it a valuable tool for research and a promising candidate for therapeutic use. Further studies and clinical trials are needed to fully explore the potential of this biosimilar in the treatment of various diseases.

SDS-PAGE for Research Grade Nezastomig

SDS-PAGE for Research Grade Nezastomig

Research Grade Nezastomig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Nezastomig Biosimilar - Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb - Research Grade

There are no reviews yet.

Be the first to review “Nezastomig Biosimilar – Anti-NAALAD1; T-cell-specific surface glycoprotein CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products