Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2117-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name PX-TA2117-50
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2460399-39-5
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2117
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade: A Revolutionary Antibody for Therapeutic Targeting

Introduction

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade is a monoclonal antibody (mAb) that has been developed as a biosimilar to the well-known anti-CD152 mAb. This biosimilar has been designed to target and inhibit CD152, a protein that plays a crucial role in regulating the immune response. By targeting CD152, this biosimilar has the potential to revolutionize the treatment of various diseases, making it a highly promising therapeutic agent.

Structure of Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade is a recombinant humanized IgG1 mAb that has been engineered using cutting-edge technology. It consists of two heavy chains and two light chains, and has a molecular weight of approximately 150 kDa. The antibody has a unique binding site that specifically recognizes and binds to CD152 on the surface of immune cells.

Mechanism of Action

CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), is a key immune checkpoint receptor that negatively regulates T-cell activation. When activated, CD152 inhibits the immune response, preventing the excessive activation of T-cells and the development of autoimmune diseases. However, in certain diseases such as cancer, CD152 can be overexpressed, leading to immune evasion and disease progression. Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade works by binding to CD152 and blocking its inhibitory function, thereby enhancing the immune response against cancer cells and other diseases.

Applications of Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade

Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade has shown great potential in the treatment of various diseases, including cancer, autoimmune diseases, and transplant rejection. In cancer, this biosimilar can be used as a monotherapy or in combination with other therapies to enhance the immune response against tumors. In autoimmune diseases, it can be used to suppress the overactive immune response and reduce inflammation. In transplant rejection, it can be used to prevent the rejection of transplanted organs by modulating the immune response.

Efficacy in Cancer

In clinical trials, Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade has shown promising results in the treatment of various types of cancer, including melanoma, lung cancer, and renal cell carcinoma. In a phase III trial for metastatic melanoma, this biosimilar was found to significantly improve overall survival compared to standard treatment. Additionally, it has shown potential for use in combination with other immunotherapies, such as checkpoint inhibitors, to enhance their efficacy and overcome resistance.

Potential in Autoimmune Diseases

Autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, are characterized by an overactive immune response. In preclinical studies, Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade has shown promising results in suppressing the immune response and reducing disease severity. It has the potential to become a valuable treatment option for these diseases, providing a safer and more targeted approach compared to current therapies.

Role in Transplant Rejection

Transplant rejection occurs when the recipient’s immune system recognizes the transplanted organ as foreign and attacks it. Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade has the potential to prevent transplant rejection by suppressing the immune response against the transpl

Research Grade Evalstotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Evalstotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Evalstotug in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Evalstotug

SDS-PAGE for Research Grade Evalstotug

Research Grade Evalstotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Evalstotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Evalstotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products