Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

Product name Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1964-50
Uniprot ID Q7Z7D3
Source CAS: 2760250-47-1
Species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA1964
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Puxitatug Biosimilar, also known as Anti-V-set domain-containing T-cell activation inhibitor 1 mAb, is a novel biosimilar antibody that is currently being researched for its potential therapeutic applications. In this article, we will discuss the structure, activity, and potential applications of Puxitatug Biosimilar in the field of immunotherapy.

Structure of Puxitatug Biosimilar

Puxitatug Biosimilar is a monoclonal antibody (mAb) that specifically targets the V-set domain-containing T-cell activation inhibitor 1 (VTCN1) protein. The antibody is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL).

The variable domains of Puxitatug Biosimilar are responsible for binding to the VTCN1 protein, which is expressed on the surface of T cells. This binding specificity is crucial for the therapeutic activity of the antibody.

Activity of Puxitatug Biosimilar

Puxitatug Biosimilar works by inhibiting the activity of the VTCN1 protein, which is a negative regulator of T cell activation. This protein is involved in the suppression of T cell responses, which can be beneficial in certain situations (such as autoimmune diseases) but detrimental in others (such as cancer).

By blocking the activity of VTCN1, Puxitatug Biosimilar allows for the activation of T cells, leading to an enhanced immune response against cancer cells. This mechanism of action makes Puxitatug Biosimilar a promising candidate for cancer immunotherapy.

Potential Applications of Puxitatug Biosimilar

Puxitatug Biosimilar is currently being researched for its potential therapeutic applications in various types of cancer, including melanoma, lung cancer, and breast cancer. It is also being evaluated for its potential to treat autoimmune diseases such as rheumatoid arthritis and multiple sclerosis.

In addition to its potential as a standalone therapy, Puxitatug Biosimilar may also have the potential to be used in combination with other cancer treatments, such as chemotherapy and immunotherapy. This could potentially enhance the effectiveness of these treatments and improve patient outcomes.

Conclusion

Puxitatug Biosimilar is a promising biosimilar antibody that targets the VTCN1 protein and has potential therapeutic applications in cancer and autoimmune diseases. Its unique mechanism of action, as well as its potential for combination therapy, make it a valuable candidate for further research and development. With ongoing studies and clinical trials, Puxitatug Biosimilar has the potential to become a valuable addition to the arsenal of cancer treatments available to patients.

SDS-PAGE for Research Grade Puxitatug

SDS-PAGE for Research Grade Puxitatug

Research Grade Puxitatug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Puxitatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Puxitatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products