Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iscalimab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Iscalimab ELISA Kit

Iscalimab ELISA Kit

Product name Iscalimab ELISA Kit
Uniprot ID P25942
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX212
Note For research use only.
Sample type Plasma, Serum
Target Iscalimab
Immunogen Iscalimab

Introduction

The Iscalimab ELISA Kit is a powerful tool for the detection and quantification of Iscalimab in various biological samples. Iscalimab, also known as CFZ533, is a fully human monoclonal antibody that targets the CD40-CD154 co-stimulatory pathway. This pathway plays a crucial role in the activation of T cells, making Iscalimab a promising therapeutic target for various autoimmune diseases and transplant rejection. In this article, we will discuss the structure, activity, and applications of the Iscalimab ELISA Kit in detail.

Structure of Iscalimab

Iscalimab is a 150 kDa glycosylated monoclonal antibody, composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains only have a variable region. The variable regions of both the heavy and light chains determine the specificity of Iscalimab for its target, CD40. The constant region of the heavy chains plays a role in the effector functions of Iscalimab, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Iscalimab works by binding to CD40 on the surface of T cells, blocking the interaction between CD40 and its ligand, CD154. This prevents the activation of T cells and subsequent production of inflammatory cytokines, such as interleukin-2 and interferon-gamma. Iscalimab also promotes the generation of regulatory T cells, which suppress immune responses and promote tolerance. These mechanisms make Iscalimab a potent immunosuppressant and a promising therapeutic option for autoimmune diseases and transplant rejection.

Applications of Iscalimab ELISA Kit

The Iscalimab ELISA Kit is a valuable tool for measuring the levels of Iscalimab in various biological samples, such as serum, plasma, and cell culture supernatants. This assay utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format, where a capture antibody specific for Iscalimab is coated onto a microplate. The Iscalimab present in the sample is then bound by the capture antibody, followed by the addition of a detection antibody specific for a different epitope on Iscalimab. The detection antibody is conjugated to an enzyme, which produces a colorimetric signal upon addition of a substrate. The intensity of this signal is directly proportional to the amount of Iscalimab present in the sample, allowing for accurate quantification.

The Iscalimab ELISA Kit has several applications in research and clinical settings. In research, it can be used to monitor the pharmacokinetics of Iscalimab in preclinical and clinical studies. It can also be used to measure the levels of Iscalimab in patient samples to assess its efficacy as a therapeutic agent. In clinical settings, the Iscalimab ELISA Kit can be used to guide dosing and monitor treatment response in patients receiving Iscalimab therapy.

Conclusion

The Iscalimab ELISA Kit is a valuable tool for the detection and quantification of Iscalimab, a promising therapeutic antibody targeting the CD40-CD154 co-stimulatory pathway. Its accurate and sensitive measurement of Iscalimab levels in various biological samples makes it a valuable asset in research and clinical settings. With the increasing interest in Iscalimab as a therapeutic agent, the Iscalimab ELISA Kit is expected to play a crucial role in the development and monitoring of Iscalimab-based therapies for autoimmune diseases and transplant rejection.

Keywords

Antibody, therapeutic target, Iscalimab, CFZ533, CD40-CD154 co-stimulatory pathway, T cells, autoimmune diseases, transplant rejection, ELISA, pharmacokinetics, treatment response.

Iscalimab ELISA Kit

There are no reviews yet.

Be the first to review “Iscalimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products