Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vunakizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Vunakizumab ELISA Kit

Vunakizumab ELISA Kit

Product name Vunakizumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX263
Note For research use only.
Sample type Plasma, Serum
Target Vunakizumab
Immunogen Vunakizumab

Introduction

Vunakizumab is a humanized monoclonal antibody that has shown promising results in the treatment of various inflammatory diseases. It specifically targets the cytokine interleukin-6 (IL-6), which plays a crucial role in the development of chronic inflammatory conditions. The Vunakizumab ELISA Kit is a specialized tool used to measure the levels of this antibody in biological samples. In this article, we will discuss the structure, activity, and applications of the Vunakizumab ELISA Kit.

Structure of Vunakizumab

Vunakizumab is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a unique variable region that specifically binds to the IL-6 cytokine, preventing its interaction with its receptor. This binding is essential for the therapeutic activity of Vunakizumab.

Activity of Vunakizumab

Vunakizumab exerts its therapeutic effects by blocking the activity of IL-6. This cytokine is a key mediator of inflammation and is involved in various pathological processes, such as autoimmune diseases, cancer, and cardiovascular diseases. IL-6 is produced by various cell types, including immune cells, and acts on a wide range of target cells. It promotes the production of acute-phase proteins, stimulates the proliferation of immune cells, and induces the differentiation of B cells into antibody-producing plasma cells.

In pathological conditions, such as rheumatoid arthritis and Crohn’s disease, there is an excessive production of IL-6, leading to chronic inflammation and tissue damage. Vunakizumab binds to IL-6 with high affinity, preventing its interaction with its receptor and inhibiting its pro-inflammatory effects. This results in a reduction of inflammation and improved clinical outcomes in patients.

Application of Vunakizumab ELISA Kit

The Vunakizumab ELISA Kit is a highly sensitive and specific tool used to measure the levels of Vunakizumab in biological samples, such as serum, plasma, and cell culture supernatants. It utilizes a sandwich ELISA method, where the Vunakizumab antibody is immobilized on a solid support and used to capture Vunakizumab present in the sample. The captured Vunakizumab is then detected using a secondary antibody conjugated to an enzyme, which produces a colorimetric signal that can be measured.

The Vunakizumab ELISA Kit has various applications in both research and clinical settings. In research, it is used to study the pharmacokinetics and pharmacodynamics of Vunakizumab, as well as to monitor its levels in patients receiving treatment. It can also be used to measure the levels of Vunakizumab in preclinical studies, where the antibody’s efficacy and safety are evaluated.

In the clinical setting, the Vunakizumab ELISA Kit is used for patient monitoring, to assess the response to treatment and determine the optimal dosing regimen. It is also used in the diagnosis of inflammatory diseases, where elevated levels of IL-6 and Vunakizumab can indicate disease activity. Additionally, the Vunakizumab ELISA Kit is used in the selection of patients for clinical trials, as it can identify individuals with high levels of IL-6, who are likely to benefit from Vunakizumab treatment.

Conclusion

In summary, the Vunakizumab ELISA Kit is a valuable tool for the measurement of Vunakizumab levels in biological samples. It plays a crucial role in the research and clinical applications of this promising antibody, which targets the pro-inflammatory cytokine IL-6. With its high sensitivity and specificity, the Vunakizumab ELISA Kit is a reliable method for monitoring Vunakizumab

Vunakizumab ELISA Kit

There are no reviews yet.

Be the first to review “Vunakizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products