Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tibulizumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tibulizumab ELISA Kit

Tibulizumab ELISA Kit

Product name Tibulizumab ELISA Kit
Uniprot ID Q16552 & Q9Y275
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX262
Note For research use only.
Sample type Plasma, Serum
Target Tibulizumab
Immunogen Tibulizumab

The Structure and Function of Tibulizumab ELISA Kit: A Powerful Tool for Antibody Detection and Therapeutic Targeting

The Basics of Tibulizumab ELISA Kit

Tibulizumab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of Tibulizumab, a monoclonal antibody that targets the human CD6 receptor. The kit utilizes an enzyme-linked immunosorbent assay (ELISA) technique, which is based on the specific binding of Tibulizumab to its target antigen, CD6, in a sample. This results in a colorimetric signal that can be measured and used to determine the amount of Tibulizumab present in the sample.

The Structure of Tibulizumab

Tibulizumab is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a high affinity and specificity for its target antigen. It is composed of two heavy chains and two light chains, with a total molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) at the ends of the arms and a crystallizable fragment (Fc) at the base. The Fab regions are responsible for binding to CD6, while the Fc region is involved in immune effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The Activity of Tibulizumab

Tibulizumab is a potent inhibitor of CD6, a cell surface glycoprotein that is primarily expressed on T cells. CD6 plays a crucial role in T cell activation, differentiation, and proliferation, making it an attractive therapeutic target for various autoimmune and inflammatory diseases. Tibulizumab binds to CD6 on T cells, preventing its interaction with its ligand, CD166, and disrupting downstream signaling pathways. This leads to the inhibition of T cell activation and cytokine production, ultimately reducing inflammation and tissue damage.

The Application of Tibulizumab ELISA Kit

Tibulizumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, the kit can be used to measure the levels of Tibulizumab in various biological samples, such as serum, plasma, and cell culture supernatants. This allows for the evaluation of Tibulizumab pharmacokinetics and pharmacodynamics, as well as the monitoring of antibody levels during clinical trials. Additionally, the kit can be used to detect and quantify Tibulizumab in preclinical studies, aiding in the development and optimization of the antibody.

In the clinical setting, Tibulizumab ELISA Kit has significant implications for the diagnosis and treatment of autoimmune and inflammatory diseases. The kit can be used to measure Tibulizumab levels in patient samples, providing valuable information for dosing and treatment monitoring. It can also be used to assess the presence of anti-drug antibodies (ADA), which can impact the effectiveness of Tibulizumab therapy. Furthermore, the kit can aid in the development of personalized treatment strategies, as it allows for the identification of patients who may benefit from Tibulizumab therapy based on their levels of CD6 expression.

Conclusion

In summary, Tibulizumab ELISA Kit is a powerful tool for the detection and quantification of Tibulizumab, a monoclonal antibody that targets the CD6 receptor. Its high sensitivity and specificity make it a valuable tool for both research and clinical applications, providing crucial information for the development and optimization of Tibulizumab therapy. With its ability to measure Tibulizumab levels and detect ADA, the kit has the potential to improve patient outcomes and contribute to the advancement of precision medicine.

Tibulizumab ELISA Kit

There are no reviews yet.

Be the first to review “Tibulizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products