Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirzotamab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirzotamab ELISA Kit

Mirzotamab ELISA Kit

Product name Mirzotamab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX266
Note For research use only.
Sample type Plasma, Serum
Target Mirzotamab
Immunogen Mirzotamab

Introduction

Mirzotamab is a novel antibody that has shown promising results in the treatment of certain types of cancer. It is a humanized monoclonal antibody that specifically targets the protein receptor tyrosine kinase-like orphan receptor 1 (ROR1). This receptor is overexpressed in various types of cancer cells, making it an attractive therapeutic target. In order to accurately measure the levels of Mirzotamab in biological samples, an ELISA kit has been developed. In this article, we will provide a scientific description of the Mirzotamab ELISA Kit, including its structure, activity, and application.

Structure of Mirzotamab ELISA Kit

The Mirzotamab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) designed for the quantitative detection of Mirzotamab in biological samples. The kit contains all the necessary components for the assay, including a pre-coated microplate, Mirzotamab-specific capture and detection antibodies, and a standard curve for quantification.

The capture antibody is coated onto the microplate and is specific for the constant region of Mirzotamab. The detection antibody is labeled with an enzyme, typically horseradish peroxidase (HRP), and is specific for the variable region of Mirzotamab. When the sample is added to the microplate, the Mirzotamab in the sample binds to the capture antibody, forming a sandwich complex with the detection antibody. The addition of a substrate for the enzyme results in a color change, which is measured spectrophotometrically and is directly proportional to the amount of Mirzotamab present in the sample.

Activity of Mirzotamab ELISA Kit

The Mirzotamab ELISA Kit has been validated for its specificity, sensitivity, precision, and accuracy. The kit has a sensitivity of <0.1 ng/mL, meaning it can detect even very low levels of Mirzotamab in biological samples. The specificity of the kit has been confirmed by testing for cross-reactivity with other antibodies and proteins, and no significant cross-reactivity was observed.

The precision of the Mirzotamab ELISA Kit has been demonstrated by performing replicate assays on the same sample, resulting in low coefficients of variation (CVs). The accuracy of the kit has been confirmed by comparing the results obtained from the ELISA with those obtained from a reference method, such as mass spectrometry.

Application of Mirzotamab ELISA Kit

The Mirzotamab ELISA Kit has a wide range of applications, including in research, drug development, and clinical trials. In research, the kit can be used to measure the levels of Mirzotamab in biological samples, such as serum, plasma, and cell culture supernatants. This can help in understanding the pharmacokinetics of Mirzotamab and its mechanism of action.

In drug development, the Mirzotamab ELISA Kit can be used to measure the levels of Mirzotamab in preclinical and clinical studies. This can help in determining the optimal dose and schedule for the drug and in evaluating its efficacy and safety. The kit can also be used in clinical trials to monitor the levels of Mirzotamab in patients and to assess its therapeutic response.

Conclusion

The Mirzotamab ELISA Kit is a valuable tool for the accurate and sensitive quantification of Mirzotamab in biological samples. Its structure, activity, and application make it a reliable and versatile assay for researchers, drug developers, and clinicians. With the growing interest in Mirzotamab as a potential therapeutic target, the Mirzotamab ELISA Kit will continue to play a crucial role in the advancement of cancer treatment.

Mirzotamab ELISA Kit

There are no reviews yet.

Be the first to review “Mirzotamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products