Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Secukinumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Secukinumab ELISA Kit

Secukinumab ELISA Kit

Product name Secukinumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX261
Note For research use only.
Sample type Plasma, Serum
Target Secukinumab
Immunogen Secukinumab

Introduction to Secukinumab ELISA Kit

The Secukinumab ELISA Kit is a highly sensitive and specific assay designed for the quantitative measurement of Secukinumab, a human monoclonal antibody, in various biological samples. This kit is an essential tool for researchers and clinicians studying the role of Secukinumab in various diseases and for monitoring its levels in patients undergoing treatment with this therapeutic agent.

Structure of Secukinumab

Secukinumab is a fully human monoclonal antibody that specifically targets and neutralizes interleukin-17A (IL-17A), a pro-inflammatory cytokine involved in the pathogenesis of various autoimmune diseases. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the heavy and light chains are responsible for binding to IL-17A, while the constant regions provide stability and effector functions.

The Secukinumab ELISA Kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format, where the capture antibody is coated on the plate and the detection antibody is labeled with an enzyme. When the sample containing Secukinumab is added to the plate, it binds to the capture antibody. The detection antibody then binds to the other end of Secukinumab, forming a sandwich complex. The enzyme attached to the detection antibody produces a color change that is directly proportional to the amount of Secukinumab present in the sample.

Activity of Secukinumab

Secukinumab exerts its therapeutic effects by specifically targeting and neutralizing IL-17A, thereby inhibiting its pro-inflammatory activity. IL-17A is produced by a variety of immune cells, including T helper 17 (Th17) cells, and is involved in the recruitment and activation of immune cells, as well as the production of other pro-inflammatory cytokines. By blocking IL-17A, Secukinumab reduces inflammation and suppresses the autoimmune response, leading to improved clinical outcomes in patients with diseases such as psoriasis, psoriatic arthritis, and ankylosing spondylitis.

Furthermore, Secukinumab has been shown to have a longer half-life compared to other IL-17A inhibitors, allowing for less frequent dosing and improved patient compliance. It also has a low immunogenicity profile, meaning it is less likely to elicit an immune response in patients, reducing the risk of adverse reactions.

Application of Secukinumab ELISA Kit

The Secukinumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, it can be used to measure the levels of Secukinumab in various biological samples, such as serum, plasma, and cell culture supernatants. This allows for the evaluation of drug pharmacokinetics, as well as the monitoring of Secukinumab levels in preclinical and clinical studies.

In the clinic, the Secukinumab ELISA Kit can be used for therapeutic drug monitoring, where the levels of Secukinumab in patient samples can be measured to ensure optimal dosing and treatment efficacy. It can also be used to assess the presence of anti-drug antibodies, which can affect the drug’s efficacy and lead to adverse reactions.

In addition, the Secukinumab ELISA Kit can be used for the detection of Secukinumab in biosimilars, ensuring the quality and consistency of these products compared to the original drug.

Conclusion

The Secukinumab ELISA Kit is a valuable tool for researchers and clinicians studying the role of Secukinumab in various diseases and for monitoring its levels in patients undergoing treatment. Its high sensitivity, specificity, and versatility make it an essential assay for the accurate measurement of Secukinumab in various biological samples.

Secukinumab ELISA Kit

There are no reviews yet.

Be the first to review “Secukinumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products