Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human TNFa Recombinant Protein |
|---|---|
| Uniprot ID | P01375 |
| Uniprot link | http://www.uniprot.org/uniprot/P01375 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Molecular weight | 18.56 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS,pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| NCBI Reference | P01375 |
| Aliases /Synonyms | DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin |
| Reference | PX-P3058 |
| Note | For research use only. |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.