Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human IL6 Recombinant Protein
| size | 100ug, 20ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human IL6 Recombinant Protein |
|---|---|
| Uniprot ID | P05231 |
| Uniprot link | http://www.uniprot.org/uniprot/P05231 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 49.8 kDa |
| Purity estimated | 95% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| NCBI Reference | P05231 |
| Aliases /Synonyms | Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2 |
| Reference | PX-P3013 |
| Note | For research use only |
Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay
Related products
Biosimilar
Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1029 200€
Biosimilar
Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1192 200€
Biosimilar
Olokizumab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1247 200€
Biosimilar
Sirukumab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1274 200€
Biosimilar
Clazakizumab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1288 200€
Biosimilar
Vobarilizumab Biosimilar – Anti-ALB, IL6R, CD126 mAb – Research Grade
PX-TA1366 200€
Biosimilar
Satralizumab Biosimilar – Anti-IL6R mAb – Research Grade
PX-TA1407 200€
Biosimilar
Levilimab Biosimilar – Anti-IL6R mAb – Research Grade
PX-TA1545 200€
Biosimilar
Ziltivekimab Biosimilar – Anti-IL6 mAb – Research Grade
PX-TA1613 200€
Receptor
Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
PX-P4046 210€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.