Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Felvizumab Biosimilar – Anti-RSV mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Felvizumab Biosimilar - Anti-RSV mAb - Research Grade

Product name Felvizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Felvizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1061-50
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Felvizumab Biosimilar: A Promising Antibody for Treating RSV Infection Introduction

Felvizumab Biosimilar, also known as anti-RSV mAb, is a monoclonal antibody that specifically targets the respiratory syncytial virus (RSV). RSV is a highly contagious virus that can cause severe respiratory infections, especially in infants, young children, and older adults. Felvizumab Biosimilar is a research-grade antibody that is currently being studied for its potential therapeutic applications in treating RSV infection.

Structure of Felvizumab Biosimilar

Felvizumab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced through genetic engineering techniques to have a structure that is similar to human antibodies. It is composed of two identical heavy chains and two identical light chains, each with a variable region and a constant region. The variable region is responsible for binding to the RSV virus, while the constant region determines the antibody’s effector functions.

Mechanism of Action

Felvizumab Biosimilar works by binding to a specific protein on the surface of the RSV virus, called the fusion (F) protein. This protein is essential for the virus to enter and infect cells in the respiratory tract. By binding to the F protein, Felvizumab Biosimilar prevents the virus from entering cells and replicating, thus inhibiting the spread of the infection.

Potential Applications

Felvizumab Biosimilar is being studied for its potential therapeutic applications in treating RSV infection. It has shown promising results in preclinical studies, demonstrating its ability to neutralize the virus and reduce viral load. This suggests that Felvizumab Biosimilar may be effective in treating RSV infection and preventing its complications, such as pneumonia and bronchiolitis.

Treatment of RSV Infection

The primary application of Felvizumab Biosimilar is in the treatment of RSV infection. It is being investigated as a potential alternative to current treatments, such as ribavirin and palivizumab, which have limited efficacy and potential side effects. Felvizumab Biosimilar has the potential to be a more effective and safer treatment option for RSV infection.

Prevention of RSV Infection

Felvizumab Biosimilar may also have the potential to prevent RSV infection. It is being studied as a potential prophylactic treatment for high-risk individuals, such as premature infants and elderly adults. By administering Felvizumab Biosimilar, it may be possible to prevent RSV infection and reduce the burden of the disease in vulnerable populations.

Combination Therapy

In addition to its potential as a standalone treatment, Felvizumab Biosimilar may also be used in combination with other therapies. It has been shown to enhance the antiviral activity of other RSV treatments, such as interferon, in preclinical studies. This suggests that Felvizumab Biosimilar may have a synergistic effect when used in combination with other anti-RSV therapies.

Conclusion

Felvizumab Biosimilar is a promising antibody for the treatment of RSV infection. Its specific targeting of the RSV virus and potential to prevent and treat the disease make it a valuable addition to the current arsenal of RSV treatments. Further research and clinical trials are needed to fully understand the potential of Felvizumab Biosimilar and its role in managing RSV infection.

SDS-PAGE for Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SDS-PAGE for Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Felvizumab Biosimilar - Anti-RSV mAb - Research Grade

There are no reviews yet.

Be the first to review “Felvizumab Biosimilar – Anti-RSV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products