Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nirsevimab ELISA Kit

Assay type:
Quantitative
Detection method:
Colorimetric
Recovery:
80-120%

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Nirsevimab ELISA Kit

Nirsevimab ELISA Kit

Product name Nirsevimab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°C)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX283
Note For research use only.
Sample type Plasma, Serum
Target Nirsevimab
Immunogen Nirsevimab
Assay type Quantitative
Detection method Colorimetric
Recovery 80-120%

Introduction to Nirsevimab ELISA Kit: A Revolutionary Tool for Therapeutic Targeting

Nirsevimab is a novel monoclonal antibody that has shown promising results in the prevention of respiratory syncytial virus (RSV) infections. RSV is a common respiratory virus that can cause serious illness, especially in infants and young children. It is estimated that RSV infections result in over 200,000 deaths annually, making it a major global health concern. In order to combat this virus, researchers have developed the Nirsevimab ELISA Kit, a cutting-edge tool for therapeutic targeting. This article will provide a comprehensive overview of the structure, activity, and potential applications of this kit.

Structure of Nirsevimab ELISA Kit

The Nirsevimab ELISA Kit is a diagnostic tool that utilizes the enzyme-linked immunosorbent assay (ELISA) technique to detect and quantify the presence of Nirsevimab in biological samples. The kit contains all the necessary reagents and materials for performing the ELISA test, including coated microplates, detection antibodies, and colorimetric substrates. The kit also comes with a detailed protocol for performing the test, making it user-friendly and accessible for researchers of all levels of expertise.

Activity of Nirsevimab ELISA Kit

The Nirsevimab ELISA Kit works by utilizing the specific binding of antibodies to their target antigen, in this case, Nirsevimab. The coated microplates in the kit contain immobilized Nirsevimab antigen, which acts as a capture antigen. When a biological sample, such as serum or plasma, is added to the microplate, any Nirsevimab present in the sample will bind to the immobilized Nirsevimab antigen. This is followed by the addition of a detection antibody that will bind to the Nirsevimab. The detection antibody is labeled with an enzyme, which produces a color change when it comes in contact with a substrate. The intensity of the color change is directly proportional to the amount of Nirsevimab present in the sample, allowing for accurate quantification.
The Nirsevimab ELISA Kit has been extensively validated for its sensitivity, specificity, and reproducibility. It has been shown to have a high sensitivity, with the ability to detect even low levels of Nirsevimab in a sample. This makes it a valuable tool for researchers studying the pharmacokinetics and pharmacodynamics of Nirsevimab, as well as for clinical trials evaluating its efficacy as a therapeutic agent.

Applications of Nirsevimab ELISA Kit

The Nirsevimab ELISA Kit has a wide range of potential applications in both research and clinical settings. In research, it can be used to study the pharmacokinetics and pharmacodynamics of Nirsevimab, as well as its mechanism of action. Additionally, it can be used to evaluate the efficacy of Nirsevimab in animal models, providing valuable insights for future clinical trials.
In the clinical setting, the Nirsevimab ELISA Kit can be used for the diagnosis and monitoring of RSV infections. It can also be used to assess the immune response to Nirsevimab in patients receiving treatment, allowing for personalized dosing and optimizing treatment outcomes. Furthermore, the kit can be used for quality control in the production of Nirsevimab, ensuring consistency and potency of the drug.

Conclusion

The Nirsevimab ELISA Kit is a revolutionary tool for the therapeutic targeting of RSV infections. Its user-friendly design and high sensitivity make it a valuable asset for researchers and clinicians alike. With its potential applications in both research and clinical settings, the Nirsevimab ELISA Kit has the potential to greatly impact the prevention and treatment of RSV infections, ultimately improving global health outcomes.

Nirsevimab ELISA Kit

There are no reviews yet.

Be the first to review “Nirsevimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products