Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Faricimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Faricimab ELISA Kit

Faricimab ELISA Kit

Product name Faricimab ELISA Kit
Uniprot ID P15692 & O15123
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX116
Note For research use only.
Sample type Plasma, Serum
Target Faricimab
Immunogen Faricimab

Introduction to Faricimab ELISA Kit

Faricimab is a novel bispecific antibody that has been developed as a potential therapeutic agent for various diseases. It is designed to simultaneously target two different pathways involved in the development of these diseases, making it a promising treatment option. To facilitate the detection and quantification of Faricimab in biological samples, an ELISA kit has been developed. In this article, we will discuss the structure, activity, and application of the Faricimab ELISA Kit.

Structure of Faricimab

Faricimab is a bispecific antibody that consists of two distinct antigen-binding domains, one targeting vascular endothelial growth factor A (VEGF-A) and the other targeting angiopoietin-2 (Ang-2). These two proteins play important roles in the development and progression of various diseases, including age-related macular degeneration (AMD) and diabetic macular edema (DME). Faricimab is a recombinant, humanized IgG1 antibody with a molecular weight of approximately 149 kDa.

The VEGF-A binding domain of Faricimab is derived from the therapeutic antibody ranibizumab, while the Ang-2 binding domain is derived from the therapeutic antibody faricimab. The two domains are connected by a flexible linker, allowing Faricimab to simultaneously bind to both targets. This unique structure of Faricimab allows for a more effective and targeted treatment approach.

Activity of Faricimab

The dual targeting activity of Faricimab is what sets it apart from other therapeutic antibodies. By binding to both VEGF-A and Ang-2, Faricimab is able to inhibit the formation of new blood vessels and reduce vascular leakage, which are key processes in the development of AMD and DME. This dual inhibition results in a more potent and sustained effect compared to single-target therapies.

Furthermore, Faricimab has been shown to have a longer half-life compared to other anti-VEGF therapies, allowing for less frequent dosing and potentially improving patient compliance. It has also been demonstrated to have a high binding affinity for both VEGF-A and Ang-2, further enhancing its therapeutic activity.

Application of Faricimab ELISA Kit

The Faricimab ELISA Kit is a valuable tool for researchers and clinicians in the development and monitoring of Faricimab therapy. It is a quantitative assay that uses a sandwich enzyme immunoassay principle to detect and measure Faricimab levels in various biological samples, such as serum, plasma, and vitreous fluid.

The Faricimab ELISA Kit is highly specific and sensitive, with a detection range of 0.1-10 ng/mL. It has been validated for use in both preclinical and clinical studies, and has been shown to have good accuracy and reproducibility. The use of this kit allows for the precise measurement of Faricimab levels, which can help in optimizing dosing regimens and monitoring treatment response.

The Faricimab ELISA Kit has also been used in pharmacokinetic studies to assess the absorption, distribution, metabolism, and excretion of Faricimab in the body. This information is crucial in understanding the pharmacological profile of Faricimab and its potential interactions with other drugs.

Conclusion

In summary, the Faricimab ELISA Kit is a valuable tool in the development and monitoring of Faricimab therapy. Its high specificity, sensitivity, and accuracy make it a reliable method for the detection and quantification of Faricimab in biological samples. The unique structure and dual targeting activity of Faricimab make it a promising therapeutic option for various diseases, and the Faricimab ELISA Kit plays a crucial role in its success.

Keywords: Faricimab, ELISA kit,

Faricimab ELISA Kit

There are no reviews yet.

Be the first to review “Faricimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products