Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cibisatamab Biosimilar – Anti-CEACAM5&CD3E;CD3E mAb – Research Grade

  • PX-TA1824-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1 Kappa; IgG1 Lambda

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade

Product name Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody
Product name Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1824-50
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody

Introduction

Cibisatamab Biosimilar, also known as Anti-CEACAM5&CD3E,CD3E mAb, is a monoclonal antibody used for therapeutic purposes. It is a biosimilar version of the original Cibisatamab, which is a fully humanized monoclonal antibody targeting CEACAM5 and CD3E antigens. This biosimilar version is produced through recombinant DNA technology and has shown promising results in preclinical and clinical studies. In this article, we will discuss the structure, activity, and potential applications of Cibisatamab Biosimilar.

Structure of Cibisatamab Biosimilar

Cibisatamab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and non-human components. It is made up of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are approximately 50 kDa in size, while the light chains are around 25 kDa. The antibody has a molecular weight of approximately 150 kDa.

The variable regions of Cibisatamab Biosimilar are derived from a mouse monoclonal antibody, while the constant regions are from a human immunoglobulin G1 (IgG1) antibody. This structure allows for high specificity and affinity towards its target antigens.

Activity of Cibisatamab Biosimilar

Cibisatamab Biosimilar works by binding to two different antigens, CEACAM5 and CD3E, on the surface of cancer cells. CEACAM5 is a glycoprotein that is overexpressed in many types of cancer, including colorectal, lung, and breast cancer. CD3E is a protein found on the surface of T cells, a type of immune cell. By targeting both antigens, Cibisatamab Biosimilar can activate T cells to attack and kill cancer cells.

Once bound to its target antigens, Cibisatamab Biosimilar triggers a cascade of immune responses, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms work by recruiting other immune cells and proteins to destroy the targeted cancer cells.

Potential Applications of Cibisatamab Biosimilar

Cibisatamab Biosimilar is currently being investigated for its potential use in the treatment of various types of cancer. Preclinical studies have shown promising results in colorectal, lung, and breast cancer models. In a phase 1 clinical trial, Cibisatamab Biosimilar showed promising results in patients with advanced solid tumors, including those with colorectal cancer.

In addition to its potential as a monotherapy, Cibisatamab Biosimilar is also being studied in combination with other cancer treatments. For example, it is being investigated in combination with chemotherapy for the treatment of colorectal cancer, and with immune checkpoint inhibitors for the treatment of lung cancer.

Conclusion

In conclusion, Cibisatamab Biosimilar is a chimeric monoclonal antibody that targets CEACAM5 and CD3E antigens on the surface of cancer cells. Its unique structure and mechanism of action make it a promising therapeutic option for various types of cancer. Further research and clinical trials are needed to fully understand the potential of this biosimilar in cancer treatment.

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 5.855M.

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.461M.

Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Cibisatamab Biosimilar – Anti-CEACAM5&CD3E;CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products