Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bosakitug Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA2178-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2178-50
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction
Bosakitug Biosimilar – Anti-TSLP mAb is a therapeutic antibody that has been developed to specifically target and inhibit the activity of thymic stromal lymphopoietin (TSLP). This biosimilar is a research grade product that has shown promising results in preclinical studies and is currently being evaluated for its potential therapeutic applications.

Structure of Bosakitug Biosimilar – Anti-TSLP mAb
Bosakitug Biosimilar – Anti-TSLP mAb is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human genetic material and has a high affinity for its target, TSLP. The mAb consists of two heavy chains and two light chains, which are joined together by disulfide bonds to form a Y-shaped structure. This structure is important for the mAb’s ability to bind to TSLP and exert its therapeutic effects.

Activity of Bosakitug Biosimilar – Anti-TSLP mAb
TSLP is a cytokine that plays a critical role in the development and maintenance of allergic and inflammatory diseases. It is produced by various cell types, including epithelial cells, and has been implicated in the pathogenesis of diseases such as asthma, atopic dermatitis, and inflammatory bowel disease. Bosakitug Biosimilar – Anti-TSLP mAb works by binding to TSLP and preventing it from binding to its receptor on immune cells. This blocks the downstream signaling pathways that lead to the production of pro-inflammatory cytokines and the activation of immune cells, ultimately reducing the inflammatory response.

Application of Bosakitug Biosimilar – Anti-TSLP mAb
Bosakitug Biosimilar – Anti-TSLP mAb has shown promising results in preclinical studies for the treatment of various allergic and inflammatory diseases. In a mouse model of asthma, treatment with this biosimilar reduced airway inflammation and hyperresponsiveness, as well as mucus production. In a mouse model of atopic dermatitis, it reduced skin inflammation and improved skin barrier function. These results suggest that Bosakitug Biosimilar – Anti-TSLP mAb has the potential to be an effective treatment option for these diseases.

Furthermore, TSLP has also been implicated in the development of certain types of cancer, such as breast cancer and lung cancer. Studies have shown that TSLP promotes tumor growth and metastasis by modulating the immune response. Therefore, Bosakitug Biosimilar – Anti-TSLP mAb may also have potential as an anti-cancer therapy by targeting TSLP and inhibiting its pro-tumorigenic effects.

Conclusion
In summary, Bosakitug Biosimilar – Anti-TSLP mAb is a research grade therapeutic antibody that has the potential to be an effective treatment option for allergic and inflammatory diseases, as well as certain types of cancer. Its specific targeting of TSLP and ability to block its activity make it a promising candidate for further clinical development. With ongoing research and clinical trials, this biosimilar has the potential to improve the lives of patients suffering from these diseases.

Bosakitug Biosimilar - Research Grade binds to Mouse TSLP recombinant protein in ELISA Assay

Bosakitug Biosimilar - Research Grade binds to Mouse TSLP recombinant protein in ELISA Assay

Mouse TSLP recombinant protein(cat. No.PX-P6400) at 0.5µg/mL (100µL/well) can bind Bosakitug Biosimilar - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Bosakitug Biosimilar - Research Grade

SDS-PAGE for Bosakitug Biosimilar - Research Grade

Bosakitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Bosakitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products