Brand: ProteoGenix

InVivoMAb Anti-Human TSLP (Iv0094)

ARO-A13281-50
Validated ELISA FC WB

Clonality:: Monoclonal Antibody
Host species:: Human

Original price was: €346.00.Current price is: €256.00.

50ug 26% OFF + 256 loyalty points

Size Size

50ug Original price was: €346.00.Current price is: €256.00.
100ug Original price was: €505.00.Current price is: €366.00.
1MG Original price was: €1,273.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for InVivoMAb Anti-Human TSLP (Iv0094)

Datasheet

InVivoMAb Anti-Human TSLP (Iv0094)

Product name	ARO-A13281-100
Uniprot ID	Q969D9
Raw Antigen Sequence	MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-TSLP, Thymic stromal lymphopoietin
Reference	ARO-A13281
Clonality	Monoclonal Antibody
Protein Name	TSLP

Product name	ARO-A13281-1MG
Uniprot ID	Q969D9
Raw Antigen Sequence	MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-TSLP, Thymic stromal lymphopoietin
Reference	ARO-A13281
Clonality	Monoclonal Antibody
Protein Name	TSLP

Product name	ARO-A13281-50
Uniprot ID	Q969D9
Raw Antigen Sequence	MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-TSLP, Thymic stromal lymphopoietin
Reference	ARO-A13281
Clonality	Monoclonal Antibody
Protein Name	TSLP

Datasheet

SDS-PAGE for InVivoMAb Anti-Human TSLP (Iv0094)

InVivoMAb Anti-Human TSLP (Iv0094), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for InVivoMAb Anti-Human TSLP (Iv0094)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human TSLP (Iv0094) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human TSLP (Iv0094)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *