Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tezepelumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tezepelumab ELISA Kit

Tezepelumab ELISA Kit

Product name Tezepelumab ELISA Kit
Uniprot ID Q969D9
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX270
Note For research use only.
Sample type Plasma, Serum
Target Tezepelumab
Immunogen Tezepelumab

The Structure of Tezepelumab ELISA Kit

Tezepelumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) kit designed for the detection of Tezepelumab, a human monoclonal antibody targeting thymic stromal lymphopoietin (TSLP). TSLP is a cytokine that plays a crucial role in the initiation and amplification of allergic and inflammatory responses. Tezepelumab is a promising therapeutic agent for the treatment of various inflammatory and allergic diseases, including asthma, atopic dermatitis, and chronic obstructive pulmonary disease (COPD).

The Tezepelumab ELISA Kit is composed of several components, including a microplate coated with a monoclonal antibody specific to Tezepelumab, a biotinylated detection antibody, streptavidin-HRP conjugate, and TMB substrate solution. The Tezepelumab-specific monoclonal antibody is immobilized on the surface of the microplate, providing a solid support for the detection of Tezepelumab. The biotinylated detection antibody recognizes a different epitope on Tezepelumab and is used to capture the target antibody in a sandwich ELISA format. The streptavidin-HRP conjugate binds to the biotinylated detection antibody, and the resulting complex is detected by the addition of the TMB substrate solution, which produces a colorimetric signal proportional to the amount of Tezepelumab present in the sample.

The Activity of Tezepelumab ELISA Kit

The Tezepelumab ELISA Kit has been validated for its sensitivity, specificity, precision, and linearity. It has a detection limit of 0.1 ng/mL and can accurately measure Tezepelumab concentrations ranging from 0.156 ng/mL to 10 ng/mL. The kit has a high specificity for Tezepelumab and does not cross-react with other related cytokines or therapeutic antibodies. The intra- and inter-assay coefficients of variation are less than 10%, indicating a high level of precision and reproducibility. The standard curve generated by the Tezepelumab ELISA Kit is linear and has a correlation coefficient of 0.99, demonstrating the accuracy and reliability of the assay.

The Tezepelumab ELISA Kit is designed to be user-friendly and time-efficient, with a total assay time of only 2.5 hours. The kit can be used with a variety of sample types, including serum, plasma, and cell culture supernatant. It is suitable for both research and clinical applications, providing a valuable tool for the evaluation of Tezepelumab levels in patient samples.

The Application of Tezepelumab ELISA Kit

Tezepelumab ELISA Kit has a wide range of applications in the field of immunology and drug development. It is a valuable tool for the quantification of Tezepelumab levels in preclinical and clinical studies, allowing for the evaluation of pharmacokinetics and pharmacodynamics of the therapeutic antibody. The Tezepelumab ELISA Kit can also be used to monitor the efficacy of Tezepelumab treatment in patients with allergic and inflammatory diseases. It can provide valuable insights into the mechanism of action of Tezepelumab and its potential role in modulating the immune response.

Furthermore, the Tezepelumab ELISA Kit can be used in the development and quality control of Tezepelumab-based therapeutics. It can accurately measure the concentration of Tezepelumab in drug formulations and ensure the consistency and potency of the product. The kit can also be used to screen and select high-affinity Tezepelumab clones during the development of new therapeutic antibodies targeting TSLP.

Tezepelumab ELISA Kit

There are no reviews yet.

Be the first to review “Tezepelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products