Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade

  • PX-TA2190-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade

Product name PX-TA2190-50
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody
Product name Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody
Product name Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade

Introduction

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade is a therapeutic antibody that has shown promising results in targeting and treating various diseases. This biosimilar is a highly specific and potent monoclonal antibody that has been designed to mimic the activity of the original therapeutic antibody, but at a more affordable cost.

Structure of Zubotamig Biosimilar

Zubotamig Biosimilar is a monoclonal antibody, which means it is derived from a single clone of cells. It is a protein molecule composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. These chains are further divided into constant and variable regions, with the variable regions being responsible for binding to the target molecule.

Activity of Zubotamig Biosimilar

Zubotamig Biosimilar targets a protein called VTCN1, also known as B7-H4, which is overexpressed in various cancer cells. This protein plays a crucial role in suppressing the immune response against cancer cells, allowing them to evade detection and destruction by the immune system. By binding to VTCN1, Zubotamig Biosimilar blocks its activity and restores the immune response, leading to the destruction of cancer cells.

Application of Zubotamig Biosimilar

Zubotamig Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various cancers, including breast, lung, ovarian, and bladder cancer. It has also shown potential in treating autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, as well as infectious diseases such as HIV and hepatitis B.

Therapeutic Antibody for Cancer Treatment

Zubotamig Biosimilar is a highly specific and potent therapeutic antibody that has been specifically designed for the treatment of cancer. It has shown promising results in both in vitro and in vivo studies, with minimal side effects. It has the potential to become a more affordable alternative to the original therapeutic antibody, making it more accessible to patients.

Therapeutic Target: VTCN1

VTCN1 is a protein that is overexpressed in various cancer cells. It plays a crucial role in suppressing the immune response against cancer cells, allowing them to evade detection and destruction by the immune system. By targeting VTCN1, Zubotamig Biosimilar helps to restore the immune response and destroy cancer cells.

Research Grade Antibody

Zubotamig Biosimilar is a research grade antibody, meaning it is primarily used for research purposes and not yet approved for clinical use. However, it has shown promising results in preclinical and clinical studies and is currently undergoing further research and development for potential approval as a therapeutic antibody.

Conclusion

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade is a highly specific and potent monoclonal antibody that has shown promising results in targeting and treating various diseases, particularly cancer. Its unique structure and mechanism of action make it a promising candidate for the treatment of various cancers, autoimmune diseases, and infectious diseases. Further research and development are underway to potentially approve this biosimilar as a more affordable and accessible therapeutic antibody.

SDS-PAGE for Zubotamig Biosimilar - Research Grade

SDS-PAGE for Zubotamig Biosimilar - Research Grade

Zubotamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Zubotamig Biosimilar - Research Grade in ELISA Assay

Zubotamig Biosimilar - Research Grade in ELISA Assay

Zubotamig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products