Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade

  • PX-TA2184-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade

Product name PX-TA2184-50
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody
Product name Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody
Product name Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody

Introduction

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade is a therapeutic antibody that targets the immune checkpoint proteins LAG3 and PD1. This biosimilar is a research grade version of the FDA-approved drug Cugrastomig, which is used to treat various types of cancer. In this article, we will discuss the structure, activity, and application of Cugrastomig Biosimilar in detail.

Structure

Cugrastomig Biosimilar is a monoclonal antibody, which means it is made up of identical copies of a single type of antibody. Antibodies are proteins produced by the immune system to recognize and bind to specific targets, such as viruses or cancer cells. The structure of Cugrastomig Biosimilar is similar to that of the original drug Cugrastomig, with a few minor differences. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains are responsible for the antibody’s binding activity, while the light chains provide stability.

Activity

Cugrastomig Biosimilar works by blocking the activity of two immune checkpoint proteins, LAG3 and PD1. These proteins are found on the surface of immune cells and play a crucial role in regulating the immune response. When these proteins are activated, they suppress the activity of immune cells, allowing cancer cells to evade detection and destruction by the immune system. By blocking LAG3 and PD1, Cugrastomig Biosimilar helps to restore the normal function of immune cells and enhance their ability to recognize and attack cancer cells.

Application

Cugrastomig Biosimilar has several potential applications in cancer treatment. It can be used as a monotherapy or in combination with other cancer therapies, such as chemotherapy or radiation therapy. As a monotherapy, Cugrastomig Biosimilar has shown promising results in treating various types of cancer, including melanoma, lung cancer, and bladder cancer. When used in combination with other treatments, it can enhance their effectiveness and improve overall treatment outcomes.

Therapeutic Target: LAG3 and PD1

As mentioned earlier, Cugrastomig Biosimilar targets two immune checkpoint proteins, LAG3 and PD1. These proteins are overexpressed on the surface of immune cells in many types of cancer, making them attractive targets for cancer therapy. By blocking these proteins, Cugrastomig Biosimilar helps to restore the normal function of immune cells and unleash their full potential in fighting cancer.

Mechanism of Action

The mechanism of action of Cugrastomig Biosimilar involves binding to LAG3 and PD1 on the surface of immune cells. This binding prevents the interaction of these proteins with their ligands, which are molecules that activate them. As a result, the activity of these proteins is inhibited, leading to enhanced immune response against cancer cells.

Advantages

Cugrastomig Biosimilar has several advantages over the original drug Cugrastomig. As a research grade version, it is more affordable and easily accessible to researchers and scientists studying the role of LAG3 and PD1 in cancer. It also has a higher purity and consistency, making it a more reliable tool for research purposes.

Conclusion

In summary, Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade is a therapeutic antibody that targets the immune checkpoint proteins LAG3 and PD1. It has a similar structure to the FDA-approved drug Cugrastomig and works by blocking the activity of these proteins, thereby enhancing the immune response against cancer cells. This biosimilar has several potential applications in cancer treatment and offers advantages over the original drug. Further research and development of Cugrastomig Biosimilar could lead to improved cancer therapies and better treatment outcomes for patients.

SDS-PAGE for Cugrastomig Biosimilar - Research Grade

SDS-PAGE for Cugrastomig Biosimilar - Research Grade

Cugrastomig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Cugrastomig Biosimilar - Research Grade in ELISA Assay

Cugrastomig Biosimilar - Research Grade in ELISA Assay

Cugrastomig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products