Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dibotatug Biosimilar – Anti-Killer cell lectin-like receptor subfamily D member 1 mAb – Research Grade

  • PX-TA2186-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Dibotatug Biosimilar - Anti-Killer cell lectin-like receptor subfamily D member 1 mAb - Research Grade

Product name PX-TA2186-50
Uniprot ID Q13241
Source CAS: 2842038-48-4
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Killer cell lectin-like receptor subfamily D member 1, NK cell receptor, Natural killer cells antigen CD94, CD94, KP43, KLRD1
Reference PX-TA2186-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Dibotatug Biosimilar - Anti-Killer cell lectin-like receptor subfamily D member 1 mAb - Research Grade
Uniprot ID Q13241
Source CAS: 2842038-48-4
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Killer cell lectin-like receptor subfamily D member 1, NK cell receptor, Natural killer cells antigen CD94, CD94, KP43, KLRD1
Reference PX-TA2186-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Dibotatug Biosimilar - Anti-Killer cell lectin-like receptor subfamily D member 1 mAb - Research Grade
Uniprot ID Q13241
Source CAS: 2842038-48-4
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Killer cell lectin-like receptor subfamily D member 1, NK cell receptor, Natural killer cells antigen CD94, CD94, KP43, KLRD1
Reference PX-TA2186-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Dibotatug Biosimilar – Anti-Killer cell lectin-like receptor subfamily D member 1 mAb – Research Grade is a therapeutic antibody that has been developed as a biosimilar to a well-known therapeutic antibody targeting the Killer cell lectin-like receptor subfamily D member 1 (KLRD1). This biosimilar has been designed to mimic the structure and function of the original therapeutic antibody, providing a more affordable and accessible option for patients in need of this treatment.

Structure of Dibotatug Biosimilar

Dibotatug Biosimilar is a monoclonal antibody (mAb) that is produced by cloning a single type of immune cell, known as a B-cell, in the laboratory. This process results in a highly specific antibody that targets a specific protein on the surface of cells. In the case of Dibotatug Biosimilar, the target protein is KLRD1, which is found on the surface of certain immune cells.

The structure of Dibotatug Biosimilar is similar to that of the original therapeutic antibody, with a variable region that binds to the target protein and a constant region that mediates the antibody’s effector functions. This structure is crucial for the antibody’s ability to recognize and bind to the target protein, leading to its therapeutic effects.

Activity of Dibotatug Biosimilar

Dibotatug Biosimilar works by binding to KLRD1 on the surface of immune cells, specifically natural killer (NK) cells and T cells. This binding blocks the interaction between KLRD1 and its ligand, resulting in the inhibition of immune cell activation and proliferation. This mechanism of action is similar to that of the original therapeutic antibody, making Dibotatug Biosimilar an effective alternative for treating conditions where KLRD1 plays a role.

The activity of Dibotatug Biosimilar has been extensively studied in preclinical and clinical trials, demonstrating its ability to effectively block KLRD1 and its therapeutic potential in various diseases. This biosimilar has shown promising results in treating autoimmune disorders, inflammatory diseases, and certain types of cancer.

Application of Dibotatug Biosimilar

Dibotatug Biosimilar is primarily used as a therapeutic antibody for the treatment of diseases where KLRD1 is a therapeutic target. This includes conditions such as rheumatoid arthritis, psoriasis, and various types of cancer.

In addition to its therapeutic applications, Dibotatug Biosimilar is also used in research settings to study the role of KLRD1 in various diseases and to develop new treatment strategies. Its availability as a research grade biosimilar allows for more affordable and accessible access to this important therapeutic target, leading to further advancements in the field of immunology.

Conclusion

In summary, Dibotatug Biosimilar – Anti-Killer cell lectin-like receptor subfamily D member 1 mAb – Research Grade is a highly specific and effective therapeutic antibody that targets KLRD1. Its structure, activity, and application make it a valuable tool for both therapeutic and research purposes. As a biosimilar, it provides a more affordable and accessible option for patients in need of this treatment, ultimately improving patient outcomes and advancing the field of immunology.

SDS-PAGE for Dibotatug Biosimilar - Research Grade

SDS-PAGE for Dibotatug Biosimilar - Research Grade

Dibotatug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Dibotatug Biosimilar - Research Grade in ELISA Assay

Dibotatug Biosimilar - Research Grade in ELISA Assay

Dibotatug Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Dibotatug Biosimilar – Anti-Killer cell lectin-like receptor subfamily D member 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products