Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade

  • PX-TA2206-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade

Product name PX-TA2206-50
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody
Product name Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody
Product name Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody

Introduction

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade is a therapeutic antibody that targets the folate receptor alpha (FBP) protein. This biosimilar is designed to mimic the activity of the reference therapeutic antibody, while providing a more affordable and accessible option for patients.

Structure of Opugotamig Biosimilar

Opugotamig Biosimilar is a monoclonal antibody (mAb) that is produced through a recombinant DNA technology. It has a similar structure to the reference therapeutic antibody, with a heavy chain and a light chain linked together by disulfide bonds. The heavy chain contains the variable region, which binds to the FBP protein, and the constant region, which determines the antibody’s effector functions. The light chain also has a variable region and a constant region, which contributes to the overall stability and specificity of the antibody.

Activity of Opugotamig Biosimilar

The main activity of Opugotamig Biosimilar is to bind to the FBP protein, which is overexpressed in many types of cancer cells. This binding prevents the FBP protein from interacting with its ligand, folate, and disrupts the cancer cells’ ability to take up essential nutrients. This leads to inhibition of cell growth and ultimately, cell death. In addition, Opugotamig Biosimilar can also activate the immune system’s response against cancer cells through its effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Application of Opugotamig Biosimilar

Opugotamig Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer, including ovarian, lung, and breast cancer. It can be used as a monotherapy or in combination with other cancer treatments, such as chemotherapy or radiation therapy. The biosimilar has the potential to provide a more affordable and accessible option for patients, while maintaining similar efficacy and safety as the reference therapeutic antibody.

Therapeutic Antibody for Cancer Treatment

Opugotamig Biosimilar belongs to the class of therapeutic antibodies, which have revolutionized the treatment of cancer in recent years. These antibodies specifically target proteins that are overexpressed or mutated in cancer cells, and can effectively inhibit tumor growth and improve patient outcomes. Unlike traditional chemotherapy, which can also kill healthy cells, therapeutic antibodies have a more targeted approach and can minimize side effects.

Therapeutic Target: Folate Receptor Alpha

The folate receptor alpha (FBP) protein is a promising therapeutic target for cancer treatment, as it is highly expressed in many types of cancer cells, including ovarian, lung, and breast cancer. FBP plays a critical role in the uptake of folate, which is essential for cell growth and division. By targeting FBP, Opugotamig Biosimilar can effectively disrupt this process and inhibit tumor growth.

Conclusion

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade is a promising therapeutic antibody for the treatment of various types of cancer. Its similar structure and activity to the reference therapeutic antibody, along with its potential for affordability and accessibility, make it a promising option for patients. By targeting the FBP protein, this biosimilar has the potential to effectively inhibit tumor growth and improve patient outcomes. Further clinical trials will provide more insight into its efficacy and safety in cancer treatment.

SDS-PAGE for Opugotamig Biosimilar - Research Grade

SDS-PAGE for Opugotamig Biosimilar - Research Grade

Opugotamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Opugotamig Biosimilar - Research Grade in ELISA Assay

Opugotamig Biosimilar - Research Grade in ELISA Assay

Opugotamig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products