Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade

Product name PX-TA2197-50
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade is a therapeutic antibody that targets the MEGT1;CD3e protein. This biosimilar is designed to mimic the activity of the original therapeutic antibody, providing a more affordable and accessible treatment option for patients.

Structure of Linclatamig Biosimilar

Linclatamig Biosimilar is a monoclonal antibody, meaning it is derived from a single type of immune cell. It is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The antibody has a Y-shaped structure, with the two arms of the Y binding to the MEGT1;CD3e protein.

Activity of Linclatamig Biosimilar

The main activity of Linclatamig Biosimilar is to bind to the MEGT1;CD3e protein on the surface of immune cells. This binding triggers a signaling cascade that activates the immune cells, leading to their proliferation and activation. This activation of immune cells is crucial for fighting off infections and diseases.

In addition to its direct activity on immune cells, Linclatamig Biosimilar also has an indirect activity through its ability to bind to the Fc receptors on other cells. This binding can trigger immune responses in these cells, further enhancing the body’s defense mechanisms.

Application of Linclatamig Biosimilar

The main application of Linclatamig Biosimilar is in the treatment of diseases that involve dysregulated immune responses, such as autoimmune diseases and certain types of cancer. By targeting the MEGT1;CD3e protein, this biosimilar can help to regulate and enhance the immune response, leading to improved outcomes for patients.

Some specific diseases that Linclatamig Biosimilar may be used to treat include rheumatoid arthritis, multiple sclerosis, and certain types of leukemia. It may also be used in combination with other therapies to enhance their effectiveness.

Research Grade

Linclatamig Biosimilar is classified as a research grade therapeutic antibody, meaning it is primarily used for research purposes rather than clinical use. This allows scientists and researchers to study its structure, activity, and potential applications in a controlled laboratory setting.

However, as more research and clinical trials are conducted, Linclatamig Biosimilar may eventually be approved for clinical use and become a valuable treatment option for patients.

Conclusion

In summary, Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade is a therapeutic antibody that targets the MEGT1;CD3e protein. Its structure, activity, and application make it a promising candidate for the treatment of various diseases involving dysregulated immune responses. As further research and clinical trials are conducted, this biosimilar may become an important tool in the fight against these diseases.

SDS-PAGE for Linclatamig Biosimilar - Research Grade

SDS-PAGE for Linclatamig Biosimilar - Research Grade

Linclatamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products