Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

VSVG Protein- Drosophila VSVG NJ Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Insect

Applications

Elisa, WB

Product nameVSVG Protein- Drosophila VSVG NJ Recombinant Protein
Uniprot IDP15425
Uniprot linkhttp://www.uniprot.org/uniprot/P15425
Origin speciesDrosophila
Expression systemEukaryotic expression
SequenceMLSYLILAIVVSPILGKIEIVFPQHTTGDWKRVPHEYNYCPTSADKNSHGTQTGIPVELTMPKGLTTHQVDGFMCHSALW MTTCDFRWYGPKYITHSIHNEEPTDYQCLEAIKAYKDGVSFNPGFPPQSCGYGTVTDAEAHIITVTPHSVKVDEYTGEWI DPHFIGGRCKGKICETVHNSTKWFTSSDGESVCSQLFTIVGGTFFSDSEEITSMGLPETGIRSNYFPYISTEGICKMPFC RKPGYKLKNDLWFQITDPDLDKKVRDLPHIKDCDLSSSIITPGEHATDISLISDVERILDYALCQSTWSKIEAGEPVTPV DLSYLGPKNPGVGPVFTIINGSLHYFTSKYLRVELESPVIPRMEGKVAGTRIVRQLWDQWFPFGEAEIGPNGVLKTKQGY KFPLHIIGTGEVDSDIKMERTVKHWEHPHIEAAQTYLKKDDTEEVIYYGDTGVSKNPVELVEGWFSGWRSSIMGVVAVIF GFVILILLIRLIGVLSSLFRPKKRPIYKSDVEMAHFRGGHNHRHKH
Molecular weight59.11kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesInsect
Fragment TypeFull-length
Protein AccessionNP_476656.1
Spec:Entrez GeneID33271
Spec:NCBI Gene AliasesCG3966, NINAA, DmelCG3966, ninA, NinaA
Spec:SwissProtIDP15425
NCBI ReferenceNP_476656.1
Aliases /SynonymsVSVG, neither inactivation nor afterpotential A, Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme, PPIase, Rotamase
ReferencePX-P2099
NoteFor research use only

Description of VSVG Protein- Drosophila VSVG NJ Recombinant Protein

General Information on VSVG NJ Protein:

Vesicular stomatitis virus (VSV) glycoproteins mediate both cell attachment and membrane fusion. Unlike many other low-pH-induced viral fusion proteins, their fusogenic conformational transitions is reversible. VSV-G has a three-stage fusion kinetics:
I. G-protein conformational change which is reversible and pH-dependent.
II. Reversible trimerization and clustering of the G-protein fusion loops.
III. Folding back of a cluster of extended trimers into their post-fusion conformations.
VSV NJ glycoprotein contains 517 amino acids and is glycosylated at position 178 and 335. Unlike VSV Indiana (VSIV), another major serotype of VSV, VSV NJ is not acylated. The two serotypes also differentiate in terms of antigenic structure. VSV NJ has a faster glycoprotein folding intracellularly and with less dependence on glycosylation.

Publication

  • 1: Lenhard T, Reiländer H. Engineering the folding pathway of insect cells:_x000D_ generation of a stably transformed insect cell line showing improved folding of a_x000D_ recombinant membrane protein. Biochem Biophys Res Commun. 1997 Sep_x000D_ 29;238(3):823-30. PubMed PMID: 9325175.
  • _x000D_ _x000D_ _x000D_
  • 2: Hemenway C, Heitman J. Proline isomerases in microorganisms and small_x000D_ eukaryotes. Ann N Y Acad Sci. 1993 Nov 30;696:38-46. Review. PubMed PMID:_x000D_ 8109845.
  • _x000D_ _x000D_ _x000D_
  • 3: Larrivee DC, Conrad SK, Stephenson RS, Pak WL. Mutation that selectively_x000D_ affects rhodopsin concentration in the peripheral photoreceptors of Drosophila_x000D_ melanogaster. J Gen Physiol. 1981 Nov;78(5):521-45. PubMed PMID: 6796648; PubMed _x000D_ Central PMCID: PMC2228638.
  • _x000D_ _x000D_ _x000D_
  • 4: Pak WL, Conrad SK, Kremer NE, Larrivee DC, Schinz RH, Wong F. Photoreceptor_x000D_ function. Basic Life Sci. 1980;16:331-46. PubMed PMID: 6779798.
  • _x000D_ _x000D_ _x000D_
  • 5: Schneuwly S, Shortridge RD, Larrivee DC, Ono T, Ozaki M, Pak WL. Drosophila_x000D_ ninaA gene encodes an eye-specific cyclophilin (cyclosporine A binding protein). _x000D_ Proc Natl Acad Sci U S A. 1989 Jul;86(14):5390-4. PubMed PMID: 2664782; PubMed_x000D_ Central PMCID: PMC297628.
  • _x000D_ _x000D_ _x000D_
  • 6: Shieh BH, Stamnes MA, Seavello S, Harris GL, Zuker CS. The ninaA gene required_x000D_ for visual transduction in Drosophila encodes a homologue of cyclosporin_x000D_ A-binding protein. Nature. 1989 Mar 2;338(6210):67-70. PubMed PMID: 2493138.
  • _x000D_ _x000D_ _x000D_
  • 7: Webel R, Menon I, O'Tousa JE, Colley NJ. Role of asparagine-linked_x000D_ oligosaccharides in rhodopsin maturation and association with its molecular_x000D_ chaperone, NinaA. J Biol Chem. 2000 Aug 11;275(32):24752-9. PubMed PMID:_x000D_ 10811808.
  • _x000D_ _x000D_ _x000D_
  • 8: Kurada P, Tonini TD, Serikaku MA, Piccini JP, O'Tousa JE. Rhodopsin maturation_x000D_ antagonized by dominant rhodopsin mutants. Vis Neurosci. 1998_x000D_ Jul-Aug;15(4):693-700. PubMed PMID: 9682871.
  • _x000D_ _x000D_ _x000D_
  • 9: Bentrop J, Schwab K, Pak WL, Paulsen R. Site-directed mutagenesis of highly_x000D_ conserved amino acids in the first cytoplasmic loop of Drosophila Rh1 opsin_x000D_ blocks rhodopsin synthesis in the nascent state. EMBO J. 1997 Apr 1;16(7):1600-9._x000D_ PubMed PMID: 9130705; PubMed Central PMCID: PMC1169764.
  • _x000D_ _x000D_ _x000D_
  • 10: Ondek B, Hardy RW, Baker EK, Stamnes MA, Shieh BH, Zuker CS. Genetic_x000D_ dissection of cyclophilin function. Saturation mutagenesis of the Drosophila_x000D_ cyclophilin homolog ninaA. J Biol Chem. 1992 Aug 15;267(23):16460-6. PubMed PMID:_x000D_ 1644830.
  • _x000D_ _x000D_ _x000D_
  • 11: Zuker CS, Mismer D, Hardy R, Rubin GM. Ectopic expression of a minor_x000D_ Drosophila opsin in the major photoreceptor cell class: distinguishing the role_x000D_ of primary receptor and cellular context. Cell. 1988 May 6;53(3):475-82. PubMed_x000D_ PMID: 2966681.
  • _x000D_ _x000D_ _x000D_
  • 12: Fouillet A, Levet C, Virgone A, Robin M, Dourlen P, Rieusset J, Belaidi E,_x000D_ Ovize M, Touret M, Nataf S, Mollereau B. ER stress inhibits neuronal death by_x000D_ promoting autophagy. Autophagy. 2012 Jun;8(6):915-26. doi: 10.4161/auto.19716._x000D_ Epub 2012 Jun 1. PubMed PMID: 22660271; PubMed Central PMCID: PMC3427257.
  • _x000D_ _x000D_ _x000D_
  • 13: Mitra A, Chinchore Y, Kinser R, Dolph PJ. Characterization of two dominant_x000D_ alleles of the major rhodopsin-encoding gene ninaE in Drosophila. Mol Vis._x000D_ 2011;17:3224-33. Epub 2011 Dec 14. PubMed PMID: 22194648; PubMed Central PMCID:_x000D_ PMC3244490.
  • _x000D_ _x000D_ _x000D_
  • 14: Ahmad ST, Natochin M, Barren B, Artemyev NO, O'Tousa JE. Heterologous_x000D_ expression of bovine rhodopsin in Drosophila photoreceptor cells. Invest_x000D_ Ophthalmol Vis Sci. 2006 Sep;47(9):3722-8. PubMed PMID: 16936079.
  • _x000D_ _x000D_ _x000D_
  • 15: Ozaki K, Nagatani H, Ozaki M, Tokunaga F. Maturation of major Drosophila_x000D_ rhodopsin, ninaE, requires chromophore 3-hydroxyretinal. Neuron. 1993_x000D_ Jun;10(6):1113-9. PubMed PMID: 8318232.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “VSVG Protein- Drosophila VSVG NJ Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products