Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade

  • PX-TA1476-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade

Product name Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1476-50
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction:

Talacotuzumab Biosimilar, also known as Anti-NOTCH2, NOTCH3 mAb – Research Grade, is a monoclonal antibody that targets the NOTCH2 and NOTCH3 receptors. This biosimilar is a promising therapeutic agent for the treatment of various diseases, including cancer and autoimmune disorders. In this article, we will discuss the structure, activity, and potential applications of Talacotuzumab Biosimilar in detail.

Structure:

Talacotuzumab Biosimilar is a recombinant, humanized monoclonal antibody that is produced in a mammalian cell expression system. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody binds specifically to the NOTCH2 and NOTCH3 receptors, while the constant region mediates effector functions such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity.

Activity:

The NOTCH signaling pathway plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. Dysregulation of this pathway has been linked to the development and progression of many diseases, including cancer. Talacotuzumab Biosimilar works by binding to the extracellular domain of NOTCH2 and NOTCH3 receptors, thereby inhibiting their activation and downstream signaling. This leads to the inhibition of tumor growth and promotion of cell death in cancer cells. Moreover, Talacotuzumab Biosimilar has been shown to modulate the immune response by promoting the differentiation of immune cells, such as T cells and dendritic cells, which can further enhance its anti-tumor activity.

Application:

Talacotuzumab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various cancers, including acute myeloid leukemia, multiple myeloma, and solid tumors. The biosimilar has also shown potential in the treatment of autoimmune disorders, such as multiple sclerosis and rheumatoid arthritis, by modulating the immune response. Additionally, Talacotuzumab Biosimilar has been investigated as a potential therapeutic agent for the prevention of graft-versus-host disease in transplant patients.

Anti-tumor activity:

The anti-tumor activity of Talacotuzumab Biosimilar has been demonstrated in various preclinical studies. In a study on acute myeloid leukemia, treatment with Talacotuzumab Biosimilar resulted in significant inhibition of tumor growth and increased survival in mice models. Similarly, in multiple myeloma, Talacotuzumab Biosimilar showed potent anti-tumor activity by inducing cell death and inhibiting tumor growth in vitro and in vivo. Furthermore, in solid tumors, Talacotuzumab Biosimilar has shown promising results in combination with other anti- cancer agents, such as chemotherapy and immune checkpoint inhibitors.

Immunomodulatory effects:

Talacotuzumab Biosimilar has been shown to have immunomodulatory effects in various preclinical studies. In a study on multiple sclerosis, treatment with Talacotuzumab Biosimilar resulted in the differentiation of regulatory T cells, which are known to suppress immune responses and have a protective role in autoimmune disorders. Similarly, in rheumatoid arthritis, Talacotuzumab Biosimilar has been shown to decrease inflammation and joint destruction by modulating the immune response.

Conclusion:

In conclusion, Talacotuzumab Biosimilar is a promising therapeutic agent for the treatment of various diseases, including cancer and autoimmune disorders. Its specific targeting of the NOTCH2 and NOTCH3 receptors and its immunomodulatory effects make it a versatile and potentially effective treatment option. Further clinical studies will provide more insight into the efficacy and safety of this biosimilar, and it has the potential to become an important addition to the current treatment options for these diseases.

SDS-PAGE for Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade

SDS-PAGE for Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade in WB Assay

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade in WB Assay

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Talacotuzumab Biosimilar - Anti-NOTCH2,  NOTCH3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products