Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Varisacumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Varisacumab ELISA Kit

Varisacumab ELISA Kit

Product name Varisacumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX190
Note For research use only.
Sample type Plasma, Serum
Target Varisacumab
Immunogen Varisacumab

Introduction

Varisacumab is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various diseases. It specifically targets a protein called vascular endothelial growth factor receptor 2 (VEGFR2), which plays a crucial role in the formation of new blood vessels. Varisacumab is currently being studied for its potential use in the treatment of cancer, age-related macular degeneration, and other diseases that involve abnormal blood vessel growth.

Structure of Varisacumab

Varisacumab is a monoclonal antibody, which means it is produced by cloning a single type of immune cell. It is a fully humanized antibody, meaning that it is derived from human cells and has a structure similar to antibodies naturally produced in the body. Varisacumab is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are responsible for binding to VEGFR2, while the light chains help stabilize the antibody structure.

Activity of Varisacumab

Varisacumab works by binding to VEGFR2 and blocking its activity. VEGFR2 is a receptor found on the surface of cells, particularly on the cells that line blood vessels. When VEGFR2 is activated by its ligands, it triggers a signaling pathway that promotes the growth of new blood vessels. This process, known as angiogenesis, is essential for normal development and wound healing, but it can also contribute to the growth and spread of diseases such as cancer.

By binding to VEGFR2, Varisacumab prevents the ligands from binding and activating the receptor. This disrupts the signaling pathway and inhibits the growth of new blood vessels. In addition, Varisacumab can also induce the destruction of existing blood vessels, a process known as angiogenesis inhibition. This dual mechanism of action makes Varisacumab a promising therapeutic agent for diseases that involve abnormal blood vessel growth.

Application of Varisacumab

The primary application of Varisacumab is in the treatment of cancer. Many types of cancer, including lung, breast, and colon cancer, rely on angiogenesis for their growth and spread. By inhibiting angiogenesis, Varisacumab can slow down or even stop the growth of tumors. In addition, Varisacumab has been shown to enhance the effectiveness of chemotherapy and radiation therapy by improving the delivery of these treatments to the tumor site.

Another potential application of Varisacumab is in the treatment of age-related macular degeneration (AMD). This disease is characterized by abnormal blood vessel growth in the retina, which can lead to vision loss. Varisacumab has shown promising results in clinical trials for the treatment of wet AMD, the most severe form of the disease. By inhibiting angiogenesis in the retina, Varisacumab can prevent further damage and potentially improve vision in patients with wet AMD.

Varisacumab is also being investigated for its potential use in other diseases that involve angiogenesis, such as diabetic retinopathy, psoriasis, and rheumatoid arthritis. In addition, it may have a role in preventing organ rejection in transplant patients, as angiogenesis plays a crucial role in the formation of new blood vessels in transplanted organs.

The Varisacumab ELISA Kit

The Varisacumab ELISA (enzyme-linked immunosorbent assay) Kit is a diagnostic tool used to measure the levels of Varisacumab in biological samples, such as blood or tissue. This kit utilizes the specific binding of Varisacumab to VEGFR2 to detect and quantify the antibody in a sample. The kit includes all the necessary components, such as Varisacumab-coated plates, detection reagents, and standards, to perform the assay.

The Varisacumab ELISA Kit is a valuable tool for researchers and clinicians studying the pharmacokinetics and pharmacodynamics of Varisac

Varisacumab ELISA Kit

There are no reviews yet.

Be the first to review “Varisacumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products